Details for Chinese cabbage Locus Brara.A03260

Position : A01 ( 5`- 27176321 .. 27183561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03260

Protein [Map View]
MNWKLGLLIGLMLLLSITLNPTLARVTYPSRTTKKGIGNIHLNKGMKIGFRGSVSRSAHHGNDPPNHL*

DNA
ATGAATTGGAAGTTAGGTTTGCTAATTGGTTTGATGCTCCTCTTGTCTATCACACTAAACCCAACTTTGGCCAGAGTAAC
TTACCCATCTCGCACGACAAAAAAAGGGATTGGAAATATACATCTCAACAAAGGAATGAAGATCGGCTTTAGAGGGAGTG
TTTCTAGATCTGCTCATCATGGAAACGATCCACCTAATCATTTATAA