Details for Chinese cabbage Locus Brara.A03259

Position : A01 ( 5`- 27174842 .. 27176121 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03259

Protein [Map View]
MEDLIILYNPTFFFFCTLSCFIPPSPSPSPPCSVKSTLLEVSQDYPKRRFTKSSILYGFNLQWTVMSEMTSRTADVMRVS
SHCEVYEPCDDSFALVDALLADQTNLINHDPKVCMEIGCGSGYVITSLILLLKEKLPNVHYLATDTNPIAARVTNETLQA
HGVSAEVVCTDIASCLEERLAGLVDVMVVNPPYVPTPEYEVGMEGIASAWAGGENGRSVIDRVLPVVDRLLSEKGWFYLV
TLTSNYPSEICLGMRKRGYASRIVVQRSTEEENLIILKFWRDKDEEGVDKETSSESFVKQFSRSLSSFMEKQWR*

DNA
ATGGAAGATTTAATTATACTCTATAATCCAACCTTTTTCTTCTTCTGCACACTCTCTTGTTTCATTCCGCCGTCGCCGTC
GCCGTCGCCTCCTTGTTCGGTGAAATCTACCCTCCTCGAAGTTTCCCAAGACTACCCAAAACGCCGTTTCACCAAAAGCT
CGATCCTTTACGGCTTTAATCTTCAGTGGACTGTTATGTCCGAGATGACATCAAGAACCGCTGACGTCATGCGTGTAAGC
TCGCATTGCGAAGTCTACGAGCCCTGTGACGATTCCTTTGCTCTAGTTGATGCCTTACTCGCTGACCAAACCAACCTTAT
AAACCACGATCCCAAGGTTTGTATGGAGATTGGCTGCGGAAGCGGATACGTCATCACTTCACTCATCCTCCTCCTCAAAG
AGAAGCTTCCCAATGTTCATTACCTAGCCACCGACACAAACCCAATCGCCGCAAGAGTAACAAACGAGACTTTACAAGCT
CATGGTGTCTCTGCTGAGGTTGTCTGCACAGACATAGCTTCTTGTCTGGAGGAGAGACTCGCTGGGTTGGTAGATGTGAT
GGTGGTGAACCCTCCTTACGTTCCCACGCCTGAGTATGAGGTTGGTATGGAAGGTATAGCCTCTGCTTGGGCTGGAGGGG
AGAATGGGAGGAGTGTTATCGATAGAGTCTTGCCTGTTGTTGATCGTTTGCTTTCTGAGAAGGGGTGGTTTTATTTGGTG
ACGTTGACTTCGAATTACCCGTCGGAGATTTGTTTGGGGATGAGGAAGAGAGGTTATGCGTCGAGGATCGTGGTGCAGAG
GTCGACGGAGGAGGAGAATCTTATTATACTTAAGTTCTGGAGAGACAAAGATGAGGAGGGTGTGGATAAGGAGACGTCAT
CAGAATCGTTTGTGAAGCAGTTTTCGAGGTCTTTGTCATCTTTTATGGAGAAACAATGGAGGTGA