Details for Chinese cabbage Locus Brara.A03257

Position : A01 ( 5`- 27168601 .. 27169925 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03257

Protein [Map View]
MRVLLCKIQCPSFFCFCKPSPHIYAASGSLKVENTPPQASSSSTTTTVVDDNDDDDDHYVDAHAAECVDGDHAIEEKEEA
CGVEEKQEGGILKSSLKKAVLDSSREKKEKKVQWVDLMGKELAEIREFESSEEDDVRYDGDQSCVCVIL*

DNA
ATGAGGGTTTTGCTTTGTAAGATCCAGTGCCCTTCTTTCTTCTGCTTCTGCAAGCCTTCTCCTCACATCTACGCCGCATC
AGGCTCGCTTAAAGTAGAGAACACGCCTCCTCAAGCGTCTTCTTCGTCCACTACTACTACGGTTGTTGATGACAATGATG
ATGATGATGATCATTATGTTGATGCACATGCCGCAGAATGTGTTGATGGAGATCATGCTATAGAGGAAAAGGAAGAAGCT
TGTGGTGTAGAGGAGAAACAAGAAGGTGGGATCTTGAAAAGCAGTCTGAAGAAGGCGGTTTTGGATTCATCAAGGGAGAA
GAAGGAGAAGAAGGTACAGTGGGTGGATTTGATGGGGAAAGAACTTGCTGAGATCCGTGAGTTCGAGTCTAGTGAAGAAG
ATGATGTCAGATATGATGGCGATCAGAGCTGCGTTTGCGTTATTCTGTGA