Details for Chinese cabbage Locus Brara.A03255

Position : A01 ( 5`- 27153481 .. 27154768 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03255

Protein [Map View]
MTSSRGKKQVVKKMIPCCMKMGMKRGPWTAEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGG
ITPDEEDLIIRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLSEGIDPQTHKPLDAKNAHHKPGEEVSGGQNLL
EPNSSSHTDDTTVNSGNEATKITFSVFGGEDNEDFGFCYDDKFSSFLNALINDDPFDSNIPLSQPFRTQDCTGEIVGTSS
SLEHGQRIEDI*

DNA
ATGACGTCATCTAGAGGAAAGAAGCAGGTCGTGAAGAAGATGATCCCGTGCTGCATGAAGATGGGGATGAAGAGAGGACC
ATGGACGGCGGAGGAGGACGAGATTCTTGTGAGCTTCATCAAGAAAGAAGGCGAAGGAAGGTGGAGATCGCTTCCCAAAA
GAGCTGGTTTACTCCGATGTGGTAAAAGCTGCCGTCTACGGTGGATGAACTATCTACGGCCGTCTGTAAAACGCGGCGGT
ATCACTCCCGACGAGGAAGATCTCATCATCCGCCTTCATCGCCTCCTTGGCAACCGGTGGTCACTGATCGCGGGAAGGAT
ACCGGGAAGGACTGATAATGAGATTAAGAACTATTGGAACACTCATCTTCGTAAGAAACTCTTAAGTGAAGGCATTGATC
CTCAAACCCACAAGCCTCTTGATGCAAAAAATGCTCATCATAAACCCGGAGAAGAAGTTTCCGGTGGACAGAATCTTCTA
GAGCCTAATTCTAGTTCTCACACTGATGACACCACCGTTAATAGCGGAAATGAAGCTACCAAGATCACTTTCAGTGTCTT
TGGTGGTGAAGACAACGAAGACTTTGGTTTCTGTTACGATGATAAATTTTCTTCGTTTCTAAATGCGCTTATCAATGATG
ATCCTTTTGATAGTAATATTCCATTGTCCCAGCCGTTTCGGACGCAAGATTGTACTGGTGAGATTGTTGGAACGTCGTCT
AGCTTAGAACATGGCCAGAGAATAGAAGATATATGA