Details for Chinese cabbage Locus Brara.A03254

Position : A01 ( 5`- 27148235 .. 27150953 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03254

Protein [Map View]
MRGRSYTPSPPRGYGRRGRSPSPRGRYGGGGGRDRDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPR
GFGFIQYVDPADAAEAKHHMEGYLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFNDRRRSPPRYSRSPPPRRGGRTR
SRSREYNSPPPKRHQSRSVSPQERRYEKERSYSRSPPRNGSRARSGSHEKAKKSYSRSRSPRRSVSPRRNRSYTPEQARS
PVPRQSRSPSPRGERNGDRSPSQ*

DNA
ATGAGGGGAAGGAGCTACACACCATCACCGCCAAGGGGCTATGGGAGGAGGGGCAGGAGCCCTAGCCCCCGTGGCCGTTA
CGGTGGGGGTGGGGGTCGTGACAGGGATCTCCCAACCAGTCTTTTGGTTCGCAACCTTCGTCATGATTGCAGGCAAGAGG
ACCTTAGGAGGCCATTTGAGCAGTTCGGTCCTGTCAAGGACATCTACCTTCCAAGGGATTATTATACCGGAGATCCAAGG
GGGTTTGGTTTCATTCAGTATGTGGATCCTGCTGATGCTGCTGAGGCAAAACATCACATGGAAGGCTATCTTCTTCTTGG
TCGTGAGCTGACTGTCGTATTCGCAGAAGAGAACAGGAAGAAGCCAACTGAAATGAGGACAAGGGATCGAGGTGGTAGGA
GCAACAGATTCAATGACAGAAGACGTTCTCCTCCTCGCTACTCTCGTTCTCCTCCCCCTCGACGTGGCGGTAGAACGCGA
TCACGTAGCCGCGAGTATAATTCTCCTCCTCCTAAAAGACATCAGTCTAGGTCTGTCTCACCACAGGAGAGACGATACGA
GAAGGAGAGGTCTTACTCTCGTTCACCACCACGTAATGGCTCAAGGGCTCGCAGTGGGAGTCATGAGAAGGCGAAGAAAA
GCTACAGCAGGAGCAGGAGCCCAAGAAGAAGCGTGAGCCCGAGAAGGAACAGGAGCTACACTCCTGAACAAGCCAGGAGC
CCTGTTCCTAGGCAGAGCAGGAGCCCAAGCCCTCGTGGAGAAAGGAATGGAGACCGTTCTCCAAGCCAGTGA