Details for Chinese cabbage Locus Brara.A03251

Position : A01 ( 5`- 27108641 .. 27111373 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03251

Protein [Map View]
MGVSFSCQFEQDDVEAALDSVTVKSISFGDDEECKTPKRSVNFSDGTLEPTILKSMGSGGKMVVEKSVSFKGMQLERMIS
LKRSLLKEKDNAGMIARELSVLDPRNPKHEAAIKLQKVYKSFRTRRKLADCAVLVEQSWWKLLDFAELKRSSISFFDIEK
HETAISRWSRARTRAAKVGKGLSKNGKAQKLALQHWLEAIDPRHRYGHNLHFYYNKWLHCQSREPFFYWLDIGEGKEVNL
VEKCPRSKLQQQCIKYLGPMERKAYEVVVEDGKFYYKNSGEMLQTSSLEDSDSKWIFVLSTSKVLYVGKKKKGTFQHSSF
LAGEATVAAGRLVVEDGVLKAVWPHSGHYQPTEENFLDFLSFLRENDVDITDVKMSPTDEDEFSMYKQRSSHMRNHSLEE
DLEAEKTVMADPREEETTPVMDNIETPKKMESLSIFGDETQSKATEDYDSGDDDEEEEEEIFELEQESMPSEQTSPKGEE
ETKESEEVVNIPEESILKRINSKKETKSFQLGKQLSCKWTTGAGPRIGCVRDYPSELQFQALEQVNLSPRCGSVSRLCFS
SSSQTQTPQMSPLWKSLPGEITDS*

DNA
ATGGGTGTATCATTCTCCTGTCAGTTCGAGCAAGACGACGTGGAAGCCGCTCTAGACTCCGTCACGGTCAAGTCCATAAG
CTTCGGCGATGACGAGGAGTGCAAGACTCCAAAGAGATCTGTAAATTTCAGTGACGGGACTCTAGAGCCGACCATCTTGA
AATCCATGGGATCTGGTGGCAAAATGGTCGTTGAGAAGTCCGTTAGCTTCAAAGGGATGCAGCTGGAGAGAATGATCTCG
CTCAAGAGGTCTCTCTTGAAAGAAAAAGACAATGCTGGGATGATCGCTAGAGAGCTCTCGGTTCTTGATCCGAGGAACCC
TAAACACGAAGCTGCTATCAAGTTACAGAAAGTTTACAAAAGCTTCCGTACCAGGCGAAAGCTGGCTGATTGTGCAGTAC
TTGTGGAACAAAGCTGGTGGAAGCTTTTGGATTTTGCTGAGTTGAAGAGAAGTTCTATATCTTTCTTTGATATTGAGAAG
CACGAGACCGCGATTTCGAGGTGGTCGAGAGCTAGGACTAGAGCAGCTAAGGTTGGTAAAGGTTTGTCCAAGAATGGAAA
GGCACAAAAACTTGCTCTACAACACTGGCTTGAAGCGATTGACCCGAGACATCGGTATGGACACAACTTGCACTTTTACT
ACAACAAGTGGCTTCATTGTCAGAGTAGAGAACCATTCTTCTACTGGCTTGATATTGGAGAAGGGAAAGAAGTAAACCTT
GTGGAGAAATGTCCTAGATCAAAACTTCAGCAACAGTGCATCAAGTACCTTGGTCCGATGGAAAGGAAAGCTTATGAGGT
TGTTGTGGAAGACGGCAAGTTCTACTACAAGAACAGTGGTGAAATGCTTCAGACTTCTTCTTTGGAAGATAGTGATTCCA
AATGGATTTTCGTGCTCAGCACGTCGAAAGTGTTGTATGTTGGGAAGAAGAAGAAGGGTACGTTTCAACATTCAAGCTTC
TTAGCTGGAGAAGCTACAGTTGCTGCAGGAAGATTAGTGGTTGAGGATGGTGTTCTCAAGGCTGTGTGGCCACATAGTGG
ACATTATCAACCTACCGAAGAGAACTTCTTGGACTTCTTGTCTTTCCTTAGAGAGAATGATGTTGATATCACTGATGTAA
AGATGAGTCCTACAGATGAGGATGAGTTCTCCATGTACAAACAGAGAAGCAGTCATATGAGAAACCATTCTTTGGAAGAG
GATTTGGAGGCTGAGAAGACTGTGATGGCTGATCCAAGAGAGGAAGAAACAACTCCAGTGATGGATAATATCGAAACACC
GAAGAAGATGGAGTCTTTGAGTATATTTGGGGATGAAACACAATCCAAAGCAACTGAAGACTATGATTCAGGTGATGATG
ATGAAGAGGAAGAGGAAGAGATTTTTGAGTTAGAACAAGAATCAATGCCTTCAGAGCAAACCTCACCCAAAGGAGAAGAG
GAAACCAAAGAGAGTGAAGAAGTAGTCAATATTCCAGAAGAATCAATCCTAAAAAGGATAAATTCAAAGAAGGAAACTAA
ATCTTTCCAACTTGGGAAACAACTATCATGCAAATGGACAACGGGTGCAGGACCAAGGATCGGTTGTGTAAGAGATTACC
CATCAGAGCTTCAGTTTCAAGCACTGGAACAAGTCAACTTGTCTCCAAGATGTGGTTCTGTTTCAAGACTTTGTTTCTCC
TCATCGTCTCAAACGCAAACGCCTCAGATGTCACCGTTATGGAAATCATTACCTGGGGAAATCACAGATTCATAA