Details for Chinese cabbage Locus Brara.A03250

Position : A01 ( 5`- 27105545 .. 27107158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03250

Protein [Map View]
MAPTVSTTQFSDPAEVTEFVVNQGNGVKGLSETGIKALPDQYIQPFEERLINKFVNETDEAIPVIDMSYPDESKVAKAIC
DAAEKWGFFQVTNHGVPLEVLDNVKAATHRFFNLPVEEKSKYTKENSLSTNVRFGTSFSPRAEKALEWKDYLSLFFVSET
EASQFWPDVCKNEALDYMNKSKTMVRKLLEYLGKNLNVKELDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSS
LTILLQDQIGGLHVRSLASGNWVHVPPVPGSFVINIGDAMQILSNGHYKSVEHRVLANGSNNRISVPIFVNPKPESVIGP
LPEVIANGEEPIYRDVVYSDYVRYFFKKAHDGKKTVDFAKI*

DNA
ATGGCTCCAACAGTCTCTACAACCCAATTCTCGGACCCAGCTGAAGTAACCGAGTTCGTTGTCAACCAAGGAAACGGCGT
AAAGGGTTTGTCAGAAACAGGAATAAAAGCTCTTCCAGATCAATACATTCAACCATTCGAAGAACGTCTCATCAACAAGT
TCGTCAACGAGACAGACGAAGCCATTCCTGTCATCGACATGTCGTACCCCGACGAGAGCAAAGTGGCTAAAGCTATCTGT
GACGCTGCTGAGAAATGGGGTTTCTTTCAAGTGACCAACCATGGAGTTCCTTTGGAAGTTCTTGACAACGTGAAGGCCGC
TACTCACAGATTCTTCAATCTTCCTGTAGAAGAGAAGAGCAAATACACAAAGGAGAATTCTCTGTCGACCAATGTTAGGT
TCGGTACGAGTTTCAGTCCTCGTGCAGAGAAGGCTTTGGAGTGGAAAGATTATCTCAGTCTCTTCTTTGTCTCTGAAACT
GAAGCATCACAGTTTTGGCCTGATGTTTGCAAGAATGAAGCTCTAGACTACATGAACAAGTCCAAGACAATGGTGAGGAA
GCTTCTAGAGTATTTGGGGAAGAACCTCAATGTGAAAGAGCTAGACGAGACCAAAGAGTCACTCTTCATGGGTTCGATTC
GAGTCAACCTCAACTACTATCCCATCTGTCCTAACCCTGACCTAACCGTTGGCGTTGGTCGCCACTCCGACGTGTCTTCC
CTCACCATTCTCTTACAAGACCAGATCGGTGGTCTCCACGTGCGTTCTCTGGCGTCAGGGAACTGGGTTCACGTGCCACC
GGTTCCCGGATCTTTCGTGATCAACATCGGAGACGCCATGCAGATCTTGAGCAATGGTCATTACAAGAGCGTGGAGCATC
GTGTCTTAGCTAACGGCAGCAACAACAGAATCTCGGTACCTATCTTTGTGAATCCAAAACCAGAGTCAGTGATTGGTCCT
CTTCCCGAGGTGATAGCAAATGGAGAGGAACCGATCTATAGAGACGTCGTGTACTCTGATTACGTTAGGTACTTCTTCAA
GAAGGCACATGATGGAAAGAAGACCGTTGATTTTGCCAAGATATGA