Details for Chinese cabbage Locus Brara.A03249

Position : A01 ( 5`- 27099204 .. 27101511 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03249

Protein [Map View]
MRQAPRDLKKRLETMSVYLCETTSHSAYAKAIITGFFQSVGSNVTAETSLLSVKNEIHGVFNAYGPVLLPYANTLNLQIQ
VIDTVERICLEADSSFFPAFGYIIEVLSNHGVDFEAIQVWKTRKNKERDEGTLSPREVALLTNLLGTPIGPAGAILQGYD
LGQASQDARNMGF*

DNA
ATGCGTCAAGCACCTAGGGATCTCAAAAAGAGGCTTGAGACAATGTCCGTGTACTTATGTGAAACTACTTCACACTCAGC
CTACGCAAAGGCCATAATTACTGGATTTTTCCAGTCGGTGGGGAGCAATGTAACTGCGGAAACAAGCTTGCTCTCCGTCA
AAAATGAGATCCATGGAGTTTTCAATGCTTACGGTCCGGTTCTATTACCATATGCAAATACCCTAAATTTACAAATCCAA
GTGATCGATACTGTGGAGAGAATCTGCCTTGAAGCGGACTCATCGTTTTTTCCAGCTTTCGGTTACATAATTGAGGTTCT
GTCGAACCACGGTGTGGACTTCGAAGCAATTCAGGTTTGGAAAACCCGTAAGAACAAGGAACGGGATGAAGGAACGTTGT
CACCACGAGAGGTAGCGCTGCTGACAAACTTGCTGGGTACGCCGATAGGACCTGCCGGTGCGATCCTTCAGGGGTACGAT
CTTGGCCAGGCTAGCCAAGACGCCAGAAACATGGGCTTCTAA