Details for Chinese cabbage Locus Brara.A03248

Position : A01 ( 5`- 27090016 .. 27092513 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03248

Protein [Map View]
MADRLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCIGCGICVKKCPFEAIQIINLPKDLE
KDTTHRYRSNAFKLHRLPVPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFDNPPDWQEILAHFRGSELQSYFTRVV
EENLKTAIKPQHVDQIKKIVQGDLGKMLEKLDERGMMEQIVADLELNPVLDRRAKDVSGGELQRFAIAAVFIKKAEIYMF
DEPSSFLDVRQRLKAAQVVRSLLRPDSYVIVVEHDLSVLDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTE
NLRFRDESLTFKVSETPQESDGEVKSYARYKYPNMSKTLGSFKLEVMEGDFTDSQIVVMLGENGTGKTTFIRMLAGALKP
DEGVEEDMPVFNVSYKPQTYDAQRECSVRQLLHERIRDAYMHPQFVSDVMKPLQIEQLLDQAICTLSGGESQRVGITLCL
GKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIMATYLADRVIVYEGQPSIKCMAHSPQSLLSGMN
LFLSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD*

DNA
ATGGCAGATCGATTGACGCGGATTGCTATTGTGAGCGAAGACCGGTGCAAACCAAAAAAATGTCGCCAGGAATGCAAGAA
GAGCTGTCCTGTTGTCAAGACAGGGAGACTTTGTATTGAAGTCACTCCTACTTCCAAGACTGCTTTCTTATCAGAGGAGC
TGTGTATAGGATGTGGTATCTGCGTGAAGAAATGCCCGTTTGAGGCTATTCAAATTATCAATCTTCCAAAGGATCTAGAG
AAAGATACAACCCACCGCTATAGGTCCAATGCTTTCAAATTGCACAGGCTCCCAGTTCCAAGGCCGGGCCAAGTCCTAGG
GTTGGTCGGGACAAACGGTATTGGGAAATCAACGGCTCTCAAAATCTTGGCTGGAAAACTTAAACCAAATCTTGGCAGGT
TCGATAATCCTCCGGACTGGCAAGAAATTTTGGCCCACTTCCGCGGGTCAGAACTTCAAAGCTATTTCACCCGAGTTGTA
GAAGAAAATCTAAAGACGGCTATAAAGCCCCAACATGTGGACCAGATAAAAAAAATTGTTCAAGGTGATCTTGGGAAGAT
GCTTGAGAAGCTGGACGAGAGAGGAATGATGGAGCAGATTGTCGCTGATCTGGAGTTGAACCCGGTACTGGACCGTAGAG
CAAAAGATGTATCTGGTGGAGAGCTTCAGAGGTTTGCCATTGCCGCTGTTTTCATCAAGAAGGCTGAGATATACATGTTT
GATGAACCATCTAGCTTCCTCGATGTGAGGCAAAGACTCAAAGCTGCTCAAGTTGTACGCTCACTCCTCAGGCCTGACAG
CTACGTGATTGTTGTGGAGCATGACCTCAGCGTCCTAGACTATTTGTCAGACTTCGTCTGCTGTCTGTATGGAAAACCAA
CAGCATATGGTGTCGTGACTCTCCCCTTTTCTGTCAGAGAAGGAATCAACGTGTTCTTGGCTGGCTTTATTCCCACTGAA
AACTTGCGTTTCAGGGACGAATCTCTGACCTTCAAGGTTTCTGAGACTCCACAAGAGAGTGATGGGGAAGTGAAGTCCTA
TGCAAGATACAAATACCCAAACATGAGTAAGACTCTTGGAAGTTTCAAGCTGGAGGTGATGGAAGGTGACTTCACCGACT
CTCAGATTGTTGTAATGCTTGGGGAGAACGGTACTGGGAAAACTACCTTCATCCGGATGCTGGCAGGTGCACTGAAACCT
GACGAGGGTGTAGAAGAAGATATGCCAGTGTTTAATGTGTCTTACAAACCGCAAACTTATGATGCGCAGCGTGAGTGTTC
AGTGAGACAGTTGCTCCATGAGAGGATCCGTGATGCTTATATGCATCCTCAATTTGTATCGGATGTAATGAAACCGCTTC
AGATTGAGCAGCTGTTGGATCAAGCAATTTGCACGCTCTCGGGTGGAGAGTCGCAGAGAGTTGGCATAACGTTATGCCTG
GGGAAGCCTGCTGATATATATCTGATAGATGAGCCAAGTGCGTATCTCGACTCTGAGCAGAGAATCACAGCGTCAAAGGT
CATAAAGCGCTTCATCCTCCACGCAAAGAAAACAGCCTTTATTGTGGAGCATGACTTTATTATGGCAACCTATCTGGCGG
ACCGAGTCATAGTGTATGAAGGACAACCATCTATCAAGTGTATGGCTCATTCTCCACAGTCACTCCTTAGCGGAATGAAC
CTCTTCTTATCGCACCTGAACATCACATTCAGACGTGATCCCACTAACTTCAGGCCAAGGATCAACAAATTAGAGTCTAC
AAAGGACAGGGAGCAGAAGTCTGCTGGCTCATACTACTACTTGGACGACTGA