Details for Chinese cabbage Locus Brara.A03243

Position : A01 ( 5`- 27064272 .. 27068631 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03243

Protein [Map View]
MPELRRGARRRGRVAEPPALNQQDKKQRRNKAVAAAVGVTERPRTRLAARKLKEEDKAIKEVAVVVVEEEEEEEEKIVMA
IGNDSGGSNKAAAAAAQEEEGNTAPFPERVQVGGSPLYKVERKLGKGGFGQVFVGRRISGGNDRSAGASILEVALKFEHR
SSKGCNYGPPHEWQVYNTLGGSHGVPRVHFKGRQGDYYIMVMDMLGPSLWDIWNTSGQAMSSEMVACIAVESLSILEKMH
AKGYVHGDVKPENFLLGQPSTSQEKKLFLVDLGLATKWREGGSGQHVEYDQRPDMFRGTVRYASAHAHLGRTASRRDDLE
SLAYTLIFLHRGRLPWQGYQGDNKSFLVCKKKMATSPDMLCCFCPPPFKQFLEIVVNMKFDEEPNYGKLVSLFQDLLGEN
PAIRPINTEGAQKIIFQVGQKRGRLSTGEEEEDAPRKKVRLGVPATQWISIYNARQPMKQRYHYNVADIRLAQHIERGIA
DGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKV
SDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILS
IPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTVS*

DNA
ATGCCTGAGCTTCGCCGTGGAGCCCGCCGCCGTGGCCGTGTCGCCGAGCCTCCAGCTCTGAATCAACAGGACAAGAAACA
GAGGAGGAACAAGGCGGTTGCTGCTGCTGTTGGAGTTACGGAGAGGCCGAGGACGAGATTAGCTGCGAGGAAGTTGAAAG
AGGAAGATAAGGCAATTAAAGAGGTAGCAGTAGTAGTGGTTGAAGAAGAAGAAGAAGAAGAAGAGAAGATAGTTATGGCG
ATTGGTAACGATAGTGGCGGCTCTAACAAGGCGGCGGCGGCGGCGGCTCAGGAGGAAGAAGGAAACACTGCTCCTTTCCC
TGAAAGGGTCCAAGTTGGGGGGTCACCGCTGTATAAGGTTGAGAGGAAGCTGGGGAAGGGTGGTTTTGGGCAAGTGTTTG
TGGGGCGTCGTATTAGTGGTGGTAATGATCGTAGTGCGGGAGCTAGCATTTTGGAGGTTGCTCTGAAGTTTGAGCATCGA
AGTAGTAAGGGTTGCAACTATGGTCCTCCACACGAGTGGCAAGTGTACAACACCTTGGGTGGGAGTCATGGAGTCCCTAG
AGTACATTTCAAAGGGAGGCAAGGAGACTATTATATCATGGTTATGGACATGCTTGGGCCGAGCTTATGGGATATATGGA
ACACTTCAGGGCAAGCAATGTCCTCAGAAATGGTAGCTTGCATTGCAGTTGAATCACTGTCCATCCTTGAAAAGATGCAT
GCAAAAGGTTATGTACATGGAGATGTTAAGCCAGAAAATTTCTTACTCGGCCAGCCTTCAACTTCTCAAGAGAAAAAGCT
GTTTCTTGTTGATTTGGGACTAGCAACAAAGTGGAGAGAAGGTGGTAGCGGACAACATGTTGAATATGATCAACGTCCGG
ATATGTTTAGGGGGACAGTTAGATACGCAAGTGCACATGCTCACTTAGGGAGAACTGCTAGCAGAAGAGATGATCTCGAA
TCATTAGCGTACACACTGATCTTCCTTCACCGAGGTAGATTGCCATGGCAAGGATATCAGGGAGATAACAAGTCATTCCT
CGTTTGCAAAAAGAAGATGGCAACATCCCCGGATATGCTTTGTTGTTTCTGCCCCCCTCCTTTCAAGCAGTTTCTTGAGA
TCGTGGTGAATATGAAGTTCGACGAGGAACCTAACTATGGGAAGCTAGTCTCTCTGTTTCAAGATCTCTTGGGGGAGAAT
CCAGCTATTAGGCCTATAAACACAGAGGGTGCTCAAAAGATCATTTTTCAAGTTGGACAGAAGCGAGGTAGGTTGAGCAC
TGGGGAAGAAGAAGAAGATGCCCCTAGGAAAAAAGTCCGTCTTGGAGTCCCTGCAACACAATGGATATCGATCTACAATG
CCAGGCAACCAATGAAGCAGAGGTATCATTACAATGTGGCTGATATAAGGCTGGCACAGCATATTGAGAGAGGTATAGCA
GATGGTTTGTTAATAAGCTGTGTATCATCATGTTCGAATCTCTGGGCATTGATAATGGATGCTGGAACTGGCTTCACAAA
CCAAGTCTACGAACTCTCTCCTGTCTTCTTGCATAAGGAATGGATAATGGAACAGTGGGAGAAGAATTACTACATAAGTT
CTATTGCTGGTGCAGCCAATGGAAGCTCCTTAGTTGTCATGTCAAAAGGCACGGCGTATACACAGCAGTCTTACAAAGTA
AGCGATTCATTCCCATTCAAGTGGATAAACAAGAAGTGGAGAGAAGGCTTCCATGTAACCTCAATGGCAACAGCTGGAAG
CAGATGGGGTGTTGTTATGTCCCGCAACTCTGGCTACAGTGAGCAGGTGGTTGAACTGGATTTTCTGTATCCGAGTGAAG
GAGTCCACAGGCGTTGGGATGGTGGATTCAGAATTACATCAACAGCAGCAACAACTGATCAAGCTGCTCTAATTCTAAGC
ATCCCACGGCGTAGACTGGTGGATGAGACACAAGAGACATTGCGTACCTCTCAGTTCCCAAGCACACATGTTAAGGAAAA
ATGGGGGAAAAATCTCTACCTTGCATCGCTAAGCTATGGCCGAACCGTATCTTAA