Details for Chinese cabbage Locus Brara.A03237

Position : A01 ( 5`- 27045698 .. 27046729 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03237

Protein [Map View]
MTNYGTIPTSSHGSPVMDPDSISRAKQRIKDGLAMSRPWRQMFDLHSMRLPHGVSEAFSRIKKNLSYFQTNYAIVVLVLI
FFSLIKHPTSLIVLTVLVFVWIFLYFFRDEPIKVFRYQIDDHTVLVCLSVITIVLLFLTDVTLNLVGALVTGAVLVLIHA
VVRKTEDLFLDEEAATAETIQD*

DNA
ATGACAAACTATGGCACCATTCCGACGTCGTCTCATGGCTCTCCGGTGATGGATCCCGACTCCATCTCACGCGCCAAGCA
ACGTATCAAAGACGGACTCGCCATGAGCCGCCCATGGAGACAGATGTTTGATCTCCACTCCATGAGGCTCCCTCACGGCG
TCTCCGAAGCTTTCTCAAGGATCAAGAAGAACCTCAGCTACTTCCAGACGAACTACGCGATCGTAGTCTTGGTCCTGATC
TTCTTCAGCCTTATCAAGCATCCGACATCGCTTATCGTCTTGACCGTTTTGGTTTTTGTCTGGATCTTTCTCTATTTCTT
TCGAGATGAACCTATCAAGGTGTTTCGTTATCAGATAGACGATCACACGGTCTTGGTTTGTTTATCGGTGATAACCATCG
TTCTTCTGTTCTTGACCGACGTGACGCTTAACTTAGTTGGGGCGTTGGTGACCGGAGCTGTGTTGGTTTTGATCCATGCG
GTTGTTAGGAAGACGGAGGATCTCTTCTTGGATGAAGAGGCGGCGACGGCTGAGACTATTCAGGACTGA