Details for Chinese cabbage Locus Brara.A03236

Position : A01 ( 5`- 27041156 .. 27044536 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03236

Protein [Map View]
MDTCSSLFLFSFLLFAIIIVIIFNKINGLRSSSASKKKIIDHVNTNSHGLVFPQGSLGWPVIGETIEFISSAYSDHPESF
MDKRRLMYGKVFKSHIFGTATIVSTDAEVNKIVLQSDPTAFVPFYPKTVRELMGKSSILLINGSLHRRFHGLVGSFLKSP
LLKAQVVKDMHKYLSESMDQWSEDQPVLLQDISKTVAFKVLAKALISVEKGEELDELKKEFEQFIKGLMSLPVNFPGTQL
HRSLQAKKKMVKQVEKIIDGKVRRAKNKEEDDVIAKDVVDVLLKDSSESLTHNLIANNMVDMMIPGHDSVPVLITLAVKF
LSDSPSALHFLTDENMELKRLKELTGEPLYWNDYLSLPFTQKVITETLRMGNVIIGVMRKAMKDVEVKGYVIPKGWCFLA
YLRSVHLDKLYYESPYKFNPWRWQERDMSTSSFSPFGGGQRLCPGLDLARLEASIFLHHLVTRFRWTTEEDTIINFPTVH
MKNKLPIWIKRR*

DNA
ATGGACACTTGTTCATCACTTTTTCTCTTCTCCTTCCTCCTCTTTGCCATCATCATCGTCATCATCTTTAACAAGATCAA
CGGTCTTAGATCATCCTCAGCTTCCAAGAAAAAAATTATTGATCATGTTAATACTAACAGCCACGGACTAGTGTTTCCAC
AAGGAAGCTTGGGATGGCCTGTCATCGGAGAAACCATCGAGTTTATCTCTTCTGCTTACTCAGACCATCCAGAGAGTTTC
ATGGACAAGCGCCGACTTATGTATGGGAAAGTGTTTAAGTCGCATATATTTGGAACTGCTACGATCGTGTCGACGGACGC
AGAAGTTAACAAAATAGTTTTACAAAGCGACCCGACCGCCTTCGTGCCCTTCTACCCAAAAACGGTGAGGGAGCTAATGG
GAAAATCGTCGATACTTCTGATAAACGGGAGTTTGCATAGAAGGTTCCATGGACTAGTCGGTTCGTTCTTAAAGTCACCA
CTTCTCAAAGCTCAAGTTGTCAAAGACATGCACAAGTATTTGTCCGAATCCATGGATCAATGGTCCGAGGACCAACCTGT
TCTCCTTCAAGATATCTCCAAGACGGTTGCATTTAAAGTACTTGCAAAGGCATTGATAAGTGTAGAGAAAGGAGAAGAGT
TAGACGAGTTAAAGAAAGAGTTTGAACAATTCATCAAAGGGCTTATGTCATTGCCAGTTAACTTCCCTGGAACCCAACTT
CATAGATCTCTCCAAGCTAAGAAGAAGATGGTGAAGCAAGTTGAAAAAATCATAGATGGCAAAGTTAGAAGAGCAAAAAA
CAAAGAAGAAGATGATGTTATTGCAAAAGATGTTGTGGATGTATTGCTTAAGGACTCAAGTGAAAGTTTAACTCACAATT
TGATTGCTAACAATATGGTTGACATGATGATTCCTGGCCACGATTCTGTACCTGTCCTCATCACCCTCGCCGTCAAATTT
CTTTCCGATTCTCCTAGTGCTCTTCATTTTTTAACGGATGAAAACATGGAGCTGAAAAGATTGAAAGAATTGACAGGAGA
GCCACTATATTGGAATGACTATTTGTCATTACCTTTTACACAAAAGGTCATTACAGAGACACTGAGAATGGGAAATGTTA
TAATTGGAGTGATGCGGAAAGCAATGAAAGATGTTGAAGTAAAAGGATACGTGATACCAAAAGGATGGTGCTTCTTGGCT
TATCTCAGATCAGTTCATCTAGATAAACTTTATTATGAGTCTCCCTACAAATTCAATCCCTGGAGATGGCAAGAAAGGGA
CATGAGCACGAGTAGTTTCAGTCCTTTTGGAGGTGGACAGAGATTGTGCCCTGGTCTCGATTTGGCCCGTCTTGAAGCTT
CAATTTTCCTTCACCATCTTGTCACTCGCTTCAGATGGACTACAGAAGAAGATACAATTATAAATTTTCCTACAGTGCAT
ATGAAGAACAAGTTACCCATTTGGATCAAAAGAAGATGA