Details for Chinese cabbage Locus Brara.A03229

Position : A01 ( 5`- 26986216 .. 26986998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03229

Protein [Map View]
MPSGKPSSSVFSLHPKPTPLKPSSSATSNNNTTNQACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKI
IKDLSPPDKDAAMYTIMFQSDARANDPIEGCYSIIRKLQYQIEYSKNELDMVIQQLAVFRNHHQEPHIQIQEPEDLSSFS
SSCDLNNNNSITYNYPLHHVQEPVQQQQEQQQYCASGNFNGLQEDMWCLQLQDSSTTVNMKGGFIDECEDVKPVEEVSSE
THEFEHHHDDFVEEPYIISS*

DNA
ATGCCATCAGGCAAACCTTCTTCTTCTGTCTTCTCTTTACATCCCAAACCAACACCATTAAAACCTTCAAGCAGCGCCAC
CAGCAACAACAACACCACAAACCAAGCATGCGCGGCTTGCAAATACCAACGTAGAAAATGTGCTCCTGATTGTCTTCTCG
CTCCTTACTTCCCTCACGACCGTCACCGCCAATTCCTCAATGCTCATAAGCTCTTCGGTGTAAGCAACATCACCAAGATC
ATAAAAGACCTTAGCCCTCCTGATAAAGACGCGGCTATGTATACAATCATGTTTCAGTCCGATGCTCGTGCGAATGATCC
CATCGAAGGATGTTATAGCATCATTAGAAAGCTTCAGTACCAGATCGAATACTCAAAAAACGAGTTGGACATGGTTATTC
AGCAATTGGCTGTGTTCCGTAATCATCATCAAGAACCGCATATTCAGATTCAAGAACCTGAGGATCTCTCGAGTTTTTCG
AGTTCTTGTGATCTAAACAACAACAACTCGATTACTTACAACTACCCTCTTCATCATGTCCAAGAACCAGTTCAACAGCA
ACAAGAACAACAACAATATTGTGCTTCTGGAAACTTTAATGGGTTACAAGAAGACATGTGGTGCCTCCAACTTCAAGATT
CATCAACGACGGTGAATATGAAGGGTGGCTTCATTGATGAATGTGAGGACGTTAAGCCTGTGGAAGAGGTTTCCAGTGAA
ACACACGAGTTCGAGCATCATCATGATGATTTCGTTGAAGAACCATACATCATTTCTTCTTAG