Details for Chinese cabbage Locus Brara.A03228

Position : A01 ( 5`- 26975270 .. 26977605 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03228

Protein [Map View]
MLQLRAKTSFKFNNTTLASLFILPTKQFGFSYSLLSSSCNPKNMVLDSKAYTKLVQKSASSGSPLLGKLAHAHMIKSSFK
PCLFLLNNLLSMYCKCRDLNLARKVFDVMPERNIISFNSLISGYSQVGFHEHSMKLFLEARDSNLKLDKFTYAGALAFCG
ERSDLGLGKLLHGLVIVNGLADQVFVVNVLINMYCKCGEVDQAMSLFDRTDEKDKETWNSLISGYVRVGLAGETLSMLAK
MHREGLKLTTYALGSVLKACCIDLKEENGMVIHCYVAKVGMECDLVVGTALLDMYAKHGSLKEAVKLFGLIPVKNVVMYN
AMISGFLHTDDITCSEKALKLFMDMQRQGLKPSPTTFSSVLKACCVAKAMEYGKQIHALVCKNNFQSDEFIGSALIELCA
LMGSPEDGMRCFASTSKRDIASWTSMIDCHVQNEELVSAFDLFRQLCCTRLRPEEYTVSLMMSACADFAALSTGEQVQGF
AIKSGIDAFTSVKTSSISMYAKSGNMPLASQIFTEVEHPDVATYSAMISCLAQHGFASDALNLFETMKTCGFRPNQQAFL
AVLIACCHGGLVTEGLNHFQAMWDEHRISPNEKHFTCLVDLLGRTGRLSEAESLILSSGFQDHPAMWKALLSSCRVYKNS
VLGRRVAERLMELEPEGSGSYVLLQNIYNESGVNSCGEEVRELMRDRGVKKEPALSCIVIGKQAHWFAVADSCHPSREMI
YGMLQQQLDTMNSVDHETLVCYVT*

DNA
ATGTTGCAACTCCGAGCAAAGACATCGTTCAAGTTCAACAACACTACTCTCGCTTCACTCTTCATTCTTCCCACCAAACA
ATTTGGATTCAGTTACAGTCTTTTGTCTTCATCATGCAACCCAAAGAACATGGTTTTGGACTCCAAAGCTTACACGAAAC
TCGTTCAAAAATCCGCGAGCTCAGGCTCCCCTCTTCTGGGCAAGCTCGCACACGCCCACATGATCAAATCCTCCTTCAAA
CCCTGCCTGTTCTTACTCAACAATCTCCTCTCCATGTACTGCAAGTGCCGAGATTTGAACCTCGCACGCAAGGTGTTCGA
CGTAATGCCTGAACGAAACATCATCTCTTTCAACTCTTTGATCTCCGGGTACAGCCAAGTTGGGTTTCACGAACACTCCA
TGAAGCTGTTCCTAGAAGCTAGAGATTCCAATTTGAAGCTCGATAAGTTCACTTACGCCGGCGCGTTGGCGTTCTGTGGA
GAAAGGTCTGATCTTGGGCTAGGGAAGTTGCTGCACGGTTTGGTAATTGTGAACGGTTTGGCTGATCAAGTCTTTGTTGT
TAATGTTTTGATTAACATGTATTGTAAGTGTGGGGAGGTTGATCAAGCAATGTCCTTGTTTGATCGAACCGATGAAAAGG
ATAAGGAGACATGGAACTCTTTGATCTCCGGGTATGTTCGTGTTGGTTTAGCGGGAGAGACGCTTAGTATGTTGGCTAAG
ATGCATAGAGAGGGTCTGAAGCTGACGACTTACGCTCTTGGGAGTGTGTTGAAGGCTTGCTGTATAGACCTGAAAGAAGA
AAACGGTATGGTTATACACTGTTATGTAGCGAAGGTAGGAATGGAATGTGATCTAGTCGTTGGTACTGCGTTGCTTGACA
TGTACGCAAAGCATGGGAGTTTGAAAGAGGCGGTAAAGCTTTTTGGTTTGATTCCTGTTAAGAATGTGGTTATGTATAAC
GCCATGATCTCTGGGTTTCTCCATACGGATGATATAACTTGTAGTGAAAAAGCCTTAAAGCTCTTCATGGATATGCAAAG
ACAGGGGTTGAAACCATCGCCGACGACGTTTTCATCTGTGCTCAAAGCTTGTTGCGTCGCGAAAGCCATGGAATATGGAA
AGCAGATCCACGCTTTGGTATGTAAGAATAACTTTCAGTCTGATGAGTTTATTGGCAGTGCTTTAATTGAGCTTTGTGCT
TTAATGGGTTCACCTGAAGACGGGATGCGGTGCTTTGCTTCAACGTCAAAGCGAGATATCGCCTCGTGGACGTCCATGAT
CGATTGCCATGTCCAAAACGAGGAGCTTGTGAGTGCGTTTGATCTGTTCCGACAGCTTTGTTGTACCCGTTTAAGACCGG
AAGAGTATACAGTCTCGCTTATGATGAGCGCTTGTGCTGATTTCGCTGCGTTGAGCACAGGAGAGCAGGTTCAAGGGTTT
GCTATAAAGAGTGGAATCGATGCTTTCACCAGCGTCAAGACCTCGAGCATATCTATGTACGCAAAGTCAGGTAACATGCC
GCTCGCGAGTCAAATCTTCACCGAGGTGGAACATCCAGACGTTGCAACGTACTCAGCTATGATCTCGTGCCTTGCGCAGC
ACGGTTTCGCTAGCGACGCCCTAAACCTCTTCGAAACGATGAAAACATGCGGGTTCAGACCGAACCAGCAGGCGTTTCTC
GCTGTTCTGATAGCCTGTTGCCACGGAGGATTAGTCACGGAAGGACTAAACCACTTCCAAGCCATGTGGGACGAGCACAG
GATCAGCCCTAACGAGAAACACTTCACTTGCCTCGTGGATCTCTTAGGTCGAACAGGAAGGTTATCAGAGGCCGAGAGTT
TGATTCTGAGCTCGGGGTTTCAAGACCATCCGGCGATGTGGAAAGCGCTGCTTAGCTCTTGCAGGGTTTACAAGAACAGC
GTGTTGGGAAGACGCGTTGCGGAGAGGTTGATGGAGCTCGAGCCCGAAGGATCTGGCTCGTATGTTTTGCTGCAGAACAT
CTACAACGAGTCTGGAGTTAACTCTTGTGGTGAAGAGGTGAGAGAGCTGATGAGGGATCGAGGGGTCAAGAAAGAACCGG
CTTTGAGCTGTATTGTGATTGGTAAACAAGCTCATTGGTTTGCGGTCGCTGACTCTTGTCACCCGTCGAGAGAGATGATC
TACGGGATGCTGCAACAGCAGTTGGATACTATGAACAGTGTAGACCATGAGACTCTTGTTTGTTATGTTACATGA