Details for Chinese cabbage Locus Brara.A03226

Position : A01 ( 5`- 26952353 .. 26952661 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03226

Protein [Map View]
MEPTAATAAAAAYGNRFRDAAAVKGYNDDSAADQTNDYQMKIKESKSVPKGDGAASRSWSFSDPESRRKRRVAGYNVYSV
KQKMKGSIRKSFKWFKNIIGTS*

DNA
ATGGAACCAACAGCTGCAACGGCCGCCGCAGCCGCTTATGGAAACCGTTTCCGAGACGCAGCTGCGGTGAAAGGTTACAA
CGACGATTCAGCTGCTGATCAGACAAACGATTACCAGATGAAGATAAAGGAAAGCAAAAGCGTTCCAAAAGGAGATGGTG
CAGCGTCAAGGAGCTGGAGTTTCAGCGATCCGGAATCACGTAGGAAGAGAAGAGTAGCTGGCTATAATGTTTACTCAGTT
AAACAGAAGATGAAAGGATCCATTAGAAAAAGCTTTAAATGGTTCAAAAACATTATAGGTACTTCTTGA