Details for Chinese cabbage Locus Brara.A03225

Position : A01 ( 5`- 26949237 .. 26951819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03225

Protein [Map View]
MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDEVHDSFDVMGLQENLLRGIYAYGFEKPSAIQQRGIVPFCKGLDVI
QQAQSGTGKTATFCSGVLQQLDFAIVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHV
VVGTPGRVFDMLKRQSLRADNIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRI
LVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDII
MREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFYNVV
VEELPSNVADLL*

DNA
ATGGCAGGATCCGCACCAGAAGGCACACAGTTTGATGCTCGTCAGTTCGACCAGAAGCTTAACGAAGTTCTCGAGGGACA
AGATGAGTTCTTCACCTCTTACGACGAGGTTCACGACAGCTTCGACGTCATGGGTCTCCAAGAGAATCTCCTCAGGGGCA
TCTACGCTTATGGTTTTGAGAAGCCATCTGCTATCCAGCAAAGAGGAATCGTCCCGTTCTGCAAAGGCCTCGACGTGATC
CAGCAAGCCCAATCCGGAACCGGCAAAACCGCCACCTTCTGCTCCGGCGTCCTCCAGCAGCTGGACTTCGCCATCGTCCA
GTGCCAAGCCCTCGTCCTCGCTCCAACCAGAGAGCTCGCCCAGCAGATCGAGAAGGTCATGAGGGCACTCGGCGACTACC
TCGGCGTCAAGGTCCACGCCTGCGTCGGCGGGACCAGCGTCCGCGAGGACCAGCGCATCCTCCAGGCCGGCGTCCACGTC
GTCGTCGGCACACCGGGGCGAGTCTTCGACATGCTGAAGAGGCAGTCCCTCCGCGCCGACAACATCAAGATGTTTGTTCT
TGATGAGGCCGACGAGATGCTCTCCCGCGGGTTCAAGGACCAGATCTACGACATCTTCCAGCTTCTCCCACCAAAGATCC
AAGTCGGCGTGTTCTCGGCGACCATGCCCCCGGAGGCTCTCGAGATCACGAGGAAGTTCATGAGCAAGCCGGTGAGGATC
CTGGTGAAGCGCGACGAGCTGACCTTGGAAGGTATCAAGCAGTTTTACGTCAACGTTGAGAAGGAGGATTGGAAGCTCGA
GACGCTCTGCGACCTCTACGAGACGCTTGCCATCACTCAGAGCGTCATCTTCGTGAACACGAGGAGGAAGGTTGACTGGC
TCACCGACAAGATGAGGGGGCGTGACCACACAGTCTCGGCTACTCACGGAGACATGGACCAGAACACGAGAGACATCATC
ATGAGGGAGTTTAGGTCTGGCTCCTCGCGTGTGCTCATCACCACTGATCTCTTGGCTCGTGGGATTGATGTCCAGCAGGT
GTCTTTGGTTATCAACTACGATCTGCCGACTCAGCCTGAGAACTACCTTCACCGTATCGGAAGAAGTGGGAGGTTCGGGA
GGAAAGGTGTGGCGATTAACTTTGTGACCAAGGATGATGAGAGGATGCTGTTTGATATCCAGAAGTTTTACAACGTTGTT
GTTGAGGAGCTTCCTTCCAACGTTGCTGATCTGCTTTGA