Details for Chinese cabbage Locus Brara.A03217

Position : A01 ( 5`- 26885000 .. 26889533 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03217

Protein [Map View]
MNMQPGLPSKASTNGSPYIRGGEREGVLNKAKSIKSHPANAASNGEAGSLKGDSRDGLVYLTTCKIGHLVEVHLKNGSVY
SGIFHAADVEKDFGIILKMASLIKDGGLRGHKARSEFVRKPPSKTFIIPADELVQVIAKDLSISSDGMSNAVQSEKSGEL
LTDSSISKSFHTDQGRELKPWIPDGDVPQGLDNVFDDPWKRGRGWDQFKVNESLFGVKSTFDEEIYTTKLDRGIRTREME
ERAQRIAREIEGENTRDLHVAEERGFQLNEKFDIDEESKYSAVLPADAFDDSGFDEEDDELLDTCNDETFGGSSTSTVQK
PVSSSGKGYGELRDASQPSRNNTNVDQMCSISDDHAQHLPSEQRSKDFTAPGSSISESQMGERRNKNNPEFSHSNRSAEE
SVSGHGDSKEGAKLGGGGTSAWKTVAEKERQVSEVSGKPKSESFTGQSASRRSSESRPGPSTSSRPGLSPSSSIGSLSSS
EKSTLNPNAKEFKLNPNAKSFKPTAAARPQSPMADASFYYPAAPAPVQQMPGMPLGYGIQPQYPGQQQMIYYPGHQHPQA
FYPPNAQPQFPQQQQQMMMGRQPRPQMVYMPPPPYQPDNPYNQGRE*

DNA
ATGAATATGCAACCTGGTCTTCCGTCTAAGGCTTCAACAAATGGATCTCCCTACATAAGAGGAGGGGAAAGAGAGGGAGT
TCTGAATAAGGCCAAGTCTATAAAGTCACATCCCGCAAATGCTGCATCCAATGGTGAAGCTGGAAGTTTGAAGGGGGATT
CACGCGATGGTTTAGTGTACCTCACAACGTGTAAGATTGGGCATCTTGTGGAAGTGCATCTGAAAAACGGATCGGTTTAT
AGTGGTATATTTCATGCTGCTGACGTGGAGAAGGATTTTGGAATCATTCTAAAGATGGCATCCTTGATTAAAGACGGTGG
TTTACGAGGGCATAAAGCCCGTTCCGAGTTTGTCAGAAAGCCACCTTCCAAGACATTCATTATTCCTGCTGATGAGCTTG
TGCAAGTTATAGCTAAGGATCTCTCCATATCCAGTGACGGCATGTCGAATGCCGTTCAGAGTGAGAAGTCGGGGGAGCTG
TTAACGGACTCTTCTATATCAAAGTCGTTTCATACCGACCAGGGAAGAGAGCTAAAACCCTGGATACCTGATGGTGATGT
TCCTCAGGGTCTGGATAATGTGTTTGATGACCCTTGGAAAAGGGGTAGGGGATGGGATCAGTTTAAGGTGAATGAGTCAC
TGTTTGGAGTCAAGAGCACTTTCGATGAGGAAATCTATACCACAAAACTTGACAGAGGTATTCGTACTAGAGAGATGGAA
GAGAGAGCGCAGAGGATTGCGAGAGAGATTGAGGGTGAAAATACCCGAGATCTTCATGTAGCAGAGGAAAGAGGCTTTCA
GCTTAATGAGAAATTTGATATTGACGAGGAATCTAAATACTCAGCTGTCCTTCCAGCTGATGCATTTGATGATAGTGGGT
TTGATGAGGAGGACGACGAATTGCTGGACACTTGCAACGATGAGACTTTTGGTGGGTCATCTACTTCTACTGTCCAGAAG
CCAGTTTCTTCTAGTGGCAAGGGATATGGAGAATTACGGGATGCCAGTCAGCCTTCTCGGAATAATACAAATGTAGATCA
AATGTGCTCGATATCTGATGATCACGCTCAGCACCTTCCCTCTGAACAGCGATCGAAAGATTTTACTGCCCCAGGCAGCA
GTATCAGTGAGAGCCAGATGGGTGAGCGAAGAAACAAGAACAATCCAGAGTTTTCCCACAGTAACAGATCAGCTGAGGAA
TCAGTTTCTGGTCATGGAGATAGCAAAGAAGGTGCAAAACTTGGTGGTGGTGGGACCTCGGCGTGGAAGACTGTTGCTGA
GAAAGAAAGGCAAGTCAGTGAAGTGTCTGGTAAACCAAAATCTGAAAGCTTTACTGGGCAGTCGGCTTCAAGAAGAAGTT
CAGAGAGCCGCCCAGGTCCTTCAACATCAAGTCGTCCTGGACTTTCACCAAGCTCGTCAATTGGTTCTTTATCATCATCA
GAAAAGTCAACGCTTAACCCGAATGCAAAGGAATTCAAACTGAATCCAAACGCAAAGAGTTTCAAACCAACAGCTGCTGC
GCGACCTCAGTCTCCAATGGCAGATGCATCATTCTACTACCCTGCTGCACCTGCACCTGTTCAGCAGATGCCTGGAATGC
CTCTTGGTTACGGAATTCAGCCGCAATATCCAGGACAGCAGCAGATGATATATTATCCTGGCCACCAGCATCCTCAAGCC
TTTTATCCTCCAAATGCACAACCCCAGTTTCCGCAGCAGCAGCAGCAAATGATGATGGGTCGTCAGCCTAGGCCGCAAAT
GGTTTACATGCCGCCTCCTCCGTACCAGCCGGACAATCCATATAATCAAGGACGAGAGTGA