Details for Chinese cabbage Locus Brara.A03213

Position : A01 ( 5`- 26871557 .. 26874345 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03213

Protein [Map View]
MATATMATAAGAAALLYYTLNRKLIAGVDDESSEASSSSTTHGASLRIDRVSHRLIQAPATWLETISTLSETLRFTYSET
LGKWPIGDLAFGINFLIKRQGLLHVDRVFGGEDSVELKGQEVADELKYYLHLLTLCWHFSKKPFPLFLEETGFVKDNVLI
HEPKAGILKPAYTVLVDHNSKCFLLLIRGTHSIKDTLTAATGGIVPFHHTVVNESGVSNLVLGYAHCGMVAAARCIAKLA
TPCLLKGLEQYPDYKIKIVGHSLGGGTAALLTYILREQKMLSTATCVTFAPAACMTWELADSGNDFIVTVINGADLVPTF
SAASVDDLRAEVTASAWLNDLRNQIERTRILSTVYRSATALGSRLPSMASAKAKVAGAGAMLRPVSSGTQVVMRRAQSML
TRPALSLSSWSCMGPRRRANATQPNSEHQIDSSEAASDPLVDTTSNNDGKWKSEAECSSYDATSASLGATDLDECEDPED
IETRQERMTEAELWQQLEHDLYNEDSSELPEEEADVAKEIKEEEEAVIAEAGVAQPEIRTPEMKESHRFLPPGKIMHIVT
VRPEAVEANEEEDALERTETVETVEEGRVGIFLTPRSLYSKVRLSQRMISDHFMPVYRRQLEKLIQELTLEQEQP*

DNA
ATGGCAACTGCAACTATGGCCACAGCAGCTGGAGCAGCTGCTCTTCTATACTACACATTAAACCGGAAGCTAATCGCCGG
TGTCGACGACGAGAGCTCCGAAGCTTCTTCTTCTTCTACTACTCATGGTGCTTCTTTGAGGATTGATCGTGTTTCGCATA
GACTTATTCAAGCTCCAGCCACTTGGCTCGAGACTATTTCAACACTCTCCGAGACTCTTCGTTTTACTTACTCCGAGACT
CTAGGGAAGTGGCCTATTGGTGATCTCGCCTTTGGTATTAACTTCCTCATCAAGAGGCAGGGGCTTCTACATGTGGATCG
TGTCTTTGGTGGGGAAGATAGTGTAGAGCTTAAAGGACAAGAAGTGGCCGATGAGCTTAAATACTATTTGCATTTGTTGA
CTCTGTGTTGGCACTTCTCCAAGAAGCCGTTTCCTTTGTTCTTGGAAGAGACTGGGTTTGTAAAGGACAACGTTCTCATT
CACGAACCCAAAGCTGGGATATTGAAACCGGCTTATACGGTTCTTGTCGATCACAACTCAAAGTGTTTTCTATTGTTGAT
CCGTGGCACGCATAGCATTAAGGACACGTTGACGGCTGCCACAGGAGGAATAGTGCCGTTCCATCACACTGTTGTGAACG
AGAGTGGTGTCAGCAACTTGGTGTTAGGGTATGCTCATTGTGGTATGGTTGCTGCTGCTAGGTGTATAGCGAAACTTGCT
ACTCCTTGTCTTCTCAAGGGTCTTGAGCAGTATCCAGATTATAAAATCAAGATCGTAGGGCACTCTTTGGGTGGTGGAAC
GGCTGCTCTATTAACGTATATATTGAGGGAGCAGAAGATGCTCTCTACAGCTACTTGTGTAACATTTGCCCCAGCTGCTT
GTATGACTTGGGAGTTAGCTGACTCTGGGAACGACTTCATTGTAACTGTGATTAATGGAGCCGATCTGGTTCCTACTTTT
TCTGCTGCATCAGTAGATGACTTACGCGCTGAGGTAACAGCATCTGCTTGGCTGAATGATCTGAGGAATCAAATCGAAAG
GACTCGAATCCTTAGTACTGTTTATCGCTCAGCGACGGCTTTAGGATCACGCCTTCCGTCTATGGCCTCTGCCAAAGCAA
AAGTTGCTGGTGCTGGTGCTATGTTACGCCCAGTGTCTAGCGGCACGCAGGTTGTGATGAGGAGAGCTCAGAGTATGCTG
ACCCGTCCTGCACTAAGCTTATCTTCTTGGTCATGTATGGGACCCAGGCGTAGAGCCAATGCTACTCAACCGAACTCGGA
ACATCAGATAGATTCTTCTGAAGCAGCTTCAGATCCTCTTGTTGATACCACAAGTAACAATGACGGGAAGTGGAAATCAG
AAGCTGAGTGTTCTAGTTATGATGCAACATCTGCTAGTCTTGGAGCAACTGATCTTGACGAGTGTGAGGATCCAGAGGAT
ATCGAAACACGGCAAGAGCGTATGACTGAAGCCGAGCTATGGCAGCAGCTGGAGCATGACCTGTACAACGAAGACTCTTC
AGAGCTGCCTGAAGAAGAAGCTGATGTGGCGAAAGAGATCAAAGAGGAAGAGGAAGCTGTGATCGCAGAGGCGGGTGTGG
CTCAGCCAGAGATCAGGACGCCTGAGATGAAAGAATCTCACAGGTTCCTCCCGCCAGGGAAGATCATGCACATTGTCACG
GTCCGGCCTGAGGCTGTAGAGGCAAACGAAGAAGAAGATGCGTTGGAAAGGACTGAGACAGTGGAGACGGTGGAGGAGGG
AAGAGTAGGAATCTTTCTGACTCCGAGGTCATTGTATAGTAAGGTGAGGTTATCGCAGAGGATGATAAGCGATCACTTCA
TGCCTGTTTACAGACGACAGCTCGAAAAGCTGATACAGGAGCTAACACTCGAACAGGAACAGCCTTGA