Details for Chinese cabbage Locus Brara.A03211

Position : A01 ( 5`- 26867279 .. 26868067 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03211

Protein [Map View]
MEMDMDTSPSYFDPEVLSVRDQFRRYRKRHSTSPPHEEVSSPNVSENRLLYDGDYIHSPTNTALLLENIKEEVDSFHTGL
YQADPISAAVASASRRESGGDVNGDDDEGMFRRVESQSLKACKAENDELAESGDTTFALFASLFDSALQGLMPIPDLILR
LEDSCRDVSQSIRYDET*

DNA
ATGGAAATGGATATGGACACTTCTCCCAGCTACTTCGACCCCGAGGTCCTCAGCGTCAGAGATCAATTCCGTCGCTACCG
GAAGAGACACTCTACATCGCCGCCGCATGAGGAAGTCTCGAGTCCGAATGTTAGTGAGAATAGGTTGCTGTACGATGGGG
ATTACATCCATAGTCCGACGAACACTGCCTTGCTTCTTGAGAACATTAAAGAAGAGGTTGATAGCTTTCACACCGGTCTT
TACCAAGCAGATCCGATCTCTGCTGCTGTTGCTTCTGCTTCCAGGAGGGAGAGTGGTGGAGATGTAAATGGTGACGACGA
TGAGGGTATGTTTCGGAGAGTAGAGAGTCAGTCGCTGAAGGCTTGCAAGGCTGAGAATGATGAGTTGGCGGAGAGTGGGG
ATACGACCTTTGCTCTGTTTGCTTCTTTATTTGATTCTGCTCTTCAAGGACTGATGCCAATTCCTGATCTAATATTGAGA
CTTGAGGATTCATGCAGGGATGTTTCACAGTCGATTAGGTATGATGAGACCTAA