Details for Chinese cabbage Locus Brara.A03210

Position : A01 ( 5`- 26861763 .. 26863089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03210

Protein [Map View]
MDQIVNVNEFQELAKRALPKMYYDFYSGGAEDQHTLKENVEAFTRIMFRPRVLVDVSKIDMSTRILGYPISAPIMIAPTA
MHMLAHPQGETATAKAAATCNTIMIVSYMASCTIEEVASSCNAIRFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVP

DNA
ATGGATCAAATCGTTAACGTGAATGAGTTTCAAGAGCTGGCCAAAAGGGCTCTCCCCAAGATGTACTATGATTTCTATAG
CGGAGGAGCAGAGGATCAACACACTCTCAAGGAAAATGTGGAAGCTTTCACTAGAATCATGTTCCGTCCTCGGGTTCTCG
TTGACGTGAGCAAGATAGATATGTCTACCAGAATCTTAGGTTACCCAATCTCAGCTCCAATCATGATTGCTCCAACAGCA
ATGCATATGTTGGCTCATCCACAAGGAGAAACCGCCACTGCGAAGGCTGCAGCTACGTGTAACACCATCATGATAGTATC
ATACATGGCTTCATGCACTATTGAGGAAGTTGCTTCCAGTTGTAATGCTATCCGGTTTCTTCAAATATATGTGTACAAGA
GACGAGATGTAACTGCACAGATTGTGAAAAGAGCTGAGAAAGCTGGATTCAAGGCCATTGTTCTGACTGTTGATGTTCCT