Details for Chinese cabbage Locus Brara.A03207

Position : A01 ( 5`- 26838748 .. 26842918 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03207

Protein [Map View]
MNTLQQMIFPDENAPIHRKKSVVTAASVLGQKKKPGGARKALNDITNKSAGAHPKPSSKTKQLAGEMFFKCIKEQQSLWD
DDDLLLHHGKALDDSSCIKEKNLKYNLTCDEPEEIPSPKLTSYMKSSTPWRSPIRHGSMMMLMPSTPLAWRFDSAEFTLK
EDYDDLF*

DNA
ATGAACACTCTTCAACAGATGATCTTCCCTGACGAGAACGCTCCCATTCATCGCAAAAAGTCTGTTGTTACAGCTGCTTC
TGTGCTTGGTCAGAAGAAGAAACCTGGAGGAGCTCGTAAGGCTCTCAATGATATCACCAACAAGTCAGCTGGGGCTCATC
CCAAACCTTCTTCCAAGACCAAGCAACTTGCTGGGGAGATGTTCTTCAAATGCATCAAGGAGCAGCAAAGTCTCTGGGAC
GATGATGATCTTTTGCTTCACCATGGTAAAGCTCTTGATGATTCTTCTTGCATCAAGGAAAAGAATCTCAAGTACAATTT
GACTTGTGACGAACCAGAAGAGATTCCATCGCCAAAGTTGACTAGTTACATGAAGAGCTCAACTCCATGGCGCTCTCCAA
TCCGCCATGGCTCTATGATGATGTTGATGCCTTCCACTCCTCTTGCTTGGCGGTTCGATTCAGCTGAATTCACACTCAAA
GAAGACTATGACGACCTCTTCTGA