Details for Chinese cabbage Locus Brara.A03201

Position : A01 ( 5`- 26790830 .. 26797108 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03201

Protein [Map View]
MPDQSCRVCYECDCQFTLINRRHHCRLCGRVFCGKCTANSIPLATSDLRAPREEWERIRVCNYCFSQWELGDGGTHLSNI
PGISSSSSETSLLSSKTITTANSSTLGSMPGLVGPYQRVKRGSDVSLHGVASKEQGKETSRSNSFIATDVEDPSRFGLNR
SDDEYDEYCAYQTDTETSHSPQANKYYGPMEYEEMSHCKHLSFETTADQKSVSGSPLIHESLESVIGEGSEQFQKKDESD
GRDESEAPSPPDISDDQVAEPVDFENNGLLWVPPDPENEEDERESSLFDEEEDNEGDASGAWGYLRPSTSFGSGEFRSED
RTSEEHKKTMKNVVDGHFRALLAQLLQVDNLPVSDEEGKEGWLEIITSLSWEAANLLKPDMSKSGGMDPGGYVKVKCLAS
GFRHDSMVVKGVVCKKNVAHRRMKAKIEKARLLIIGGALEYQRVSNQFSSFDTLLQQEKEHLKMAVAKIHAERPNILLVE
KSVSRFAQEYLLAKDISLVLNIKRPLLDRIARCTGAQIIPSVDHLSSQKLGYCENFRVDRFLEEHGQVGKKAVKTLMYFE
GCPRPLGFTILLRGANEEELKKVKHVVRYGVFAAYHLALETSFLADEGASPELPLNSPITVALPDKSTSIERSISTVPGF
TVSSIHDKSPTMISGFEPQRANSVPASELLSTTANLSFQKDINPMISNVSGWQARETNPGFVFSRCNVSLTLPDRVIEGR
NPNMSERDALADTPADKSNPSIEAADILSEGFVRKTYQSSTSVIVEPQDNGSDLTTIQQQNSEDSKEPQSQKEEFPPSPS
DHQSILVSLSSRSVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDHLFDQGYRCRSSASRVACCGHSLHRDCLRFYGFGNM
VACFRYATIDVHSVYLPPSVLSFNYDNQDWIQREIDKVAERAELLFSEVLNAISQIAVKGSRRRIGQLEELLQREKAEFE
ENMQRMLQGEVKEGQPLVDILELYRLRRQLIFQSYMWDHRLINASNLQKLESSDDTKREENEKPPLAKSQTLPEMNAGTN
TLLAGSEDNPNPDSGSTGDTGSLNKVQKEADGNLDLIQEKEDEGEVSPSNTLPDTSDPVENKLDVRRTQSDGHLVMKNLS
ATLDAAWIGERQTSEDIPANNKILLPPSSMSISEGLKPIDLPEHQKESKVAYPVSPALPSKNYENSEDSVSWLGMPFLSF
YRSINKNFLLSSQKLDTFGEHSPVYISSFREAELQGGPRLLLPVGINDVVVPVYDDEPTSMIAYALMTPEYQRQISVEGE
SLVSFPSELNIPRPVDDTIFDPSRSNSSVDESILSMSSSLRLDPLSYTKAFNARVSYGEDGTLGKVKYTVTCYYAKRFEA
LRGICLPSELEFIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKI
LGIYQVATKQLKSGKETKMDVLIMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKR
LLERAVWNDTAFLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESWVKFTGILGGPKNEAPTVISPKQYKRR
FRKAMTTYFLMVPDQWSPPEVIADNSRSDQPEETSQTGTQAE*

DNA
ATGCCTGATCAGAGCTGTCGTGTGTGTTATGAGTGTGATTGTCAGTTCACCCTTATCAACCGTAGGCATCATTGCCGTCT
TTGTGGGAGAGTCTTCTGTGGGAAATGTACTGCGAACTCAATACCTTTGGCTACCAGCGACTTGAGAGCTCCCCGTGAGG
AGTGGGAGAGGATCCGTGTTTGTAATTATTGTTTCAGCCAATGGGAGCTAGGTGATGGTGGAACGCATCTTTCGAATATT
CCGGGGATTAGTAGTTCGTCTTCTGAGACAAGTCTTCTTAGCTCAAAGACTATTACAACTGCCAATAGTAGTACTCTTGG
CTCGATGCCAGGATTGGTTGGTCCTTATCAAAGGGTTAAACGTGGTTCTGATGTCAGTTTGCACGGAGTGGCTTCTAAAG
AGCAAGGCAAAGAGACTTCAAGGAGTAACAGTTTCATAGCCACAGATGTGGAAGATCCATCTCGCTTTGGTTTAAATAGG
AGTGATGATGAGTACGATGAGTATTGTGCATACCAGACTGATACTGAGACGAGTCATTCTCCTCAAGCTAATAAATACTA
TGGCCCAATGGAATATGAGGAGATGAGCCACTGTAAGCATCTGAGTTTCGAAACCACCGCTGACCAGAAAAGCGTAAGCG
GCTCTCCACTCATTCATGAGAGTCTTGAATCTGTAATTGGGGAAGGATCAGAGCAGTTCCAGAAAAAAGATGAGAGTGAT
GGTCGTGACGAAAGTGAAGCACCTTCTCCGCCAGATATTTCGGATGATCAAGTGGCAGAGCCGGTGGATTTCGAGAACAA
TGGACTTTTGTGGGTTCCACCTGATCCAGAAAACGAAGAAGATGAGAGAGAAAGCTCTTTGTTTGACGAGGAAGAAGATA
ATGAGGGAGATGCCTCAGGTGCGTGGGGATACTTACGGCCTTCCACTAGCTTTGGAAGTGGAGAGTTCCGTAGCGAGGAT
CGAACGAGTGAGGAGCACAAAAAGACTATGAAGAATGTGGTTGATGGGCACTTTAGAGCTTTGCTTGCACAACTGTTGCA
AGTGGATAACCTCCCTGTGAGCGATGAAGAGGGCAAAGAGGGCTGGTTAGAGATTATCACCTCTCTTTCTTGGGAGGCGG
CTAACTTACTGAAGCCTGATATGAGCAAAAGTGGAGGGATGGATCCTGGTGGCTATGTCAAAGTAAAGTGCTTAGCTTCT
GGGTTTCGACATGATAGCATGGTGGTTAAGGGAGTTGTTTGCAAGAAAAATGTAGCTCATAGGAGAATGAAAGCGAAGAT
TGAGAAAGCTAGACTATTGATTATAGGCGGTGCCCTTGAGTATCAAAGGGTCTCAAACCAGTTCTCAAGTTTTGATACTT
TGCTGCAACAGGAAAAGGAGCATCTAAAGATGGCTGTTGCAAAGATTCACGCTGAACGTCCAAATATTCTACTAGTGGAA
AAATCAGTTTCTCGATTTGCGCAAGAGTATCTTCTAGCCAAAGACATATCTCTTGTTCTAAACATTAAGAGGCCACTTTT
AGACCGCATTGCTCGCTGCACCGGTGCTCAGATAATTCCTTCAGTAGATCACCTCTCCTCTCAAAAGCTGGGTTACTGTG
AAAATTTTCGGGTGGATAGGTTTCTTGAAGAACATGGTCAAGTTGGAAAGAAAGCAGTAAAGACGTTGATGTATTTTGAG
GGTTGTCCAAGGCCATTAGGATTTACAATTTTGCTTAGGGGTGCTAATGAGGAAGAGTTGAAAAAAGTGAAGCATGTGGT
CCGATATGGAGTTTTTGCAGCTTATCATTTGGCACTCGAGACATCGTTTCTTGCTGACGAAGGAGCCTCACCAGAACTCC
CCTTGAACTCCCCGATTACGGTAGCTCTTCCTGATAAATCTACAAGCATTGAAAGATCCATATCTACTGTGCCAGGTTTC
ACGGTCTCTTCCATACATGATAAATCTCCAACAATGATATCTGGTTTCGAACCACAACGAGCAAACAGTGTCCCAGCATC
AGAGTTGCTTTCGACCACTGCCAATCTGTCCTTCCAGAAGGATATAAATCCTATGATCTCCAATGTTTCAGGCTGGCAGG
CTAGAGAAACAAATCCGGGTTTCGTATTTTCACGCTGTAATGTTTCATTGACTTTGCCTGACCGTGTGATTGAGGGAAGA
AACCCAAATATGTCTGAAAGAGATGCACTGGCAGACACACCAGCAGACAAAAGCAACCCATCTATTGAGGCAGCAGACAT
ATTGTCTGAAGGCTTTGTGCGAAAGACTTATCAAAGTAGTACGAGCGTTATAGTAGAGCCCCAGGACAATGGTTCAGACC
TTACAACCATCCAACAACAAAACAGTGAGGATTCAAAGGAACCACAATCTCAAAAAGAGGAATTTCCTCCATCACCCTCT
GATCATCAGAGCATTTTGGTTTCTTTATCGTCCCGATCAGTGTGGAAAGGAACTGTGTGTGAGAGGTCTCATCTCTTCCG
GATAAAATACTATGGTAGTTTCGATAAACCATTGGGACGGTTCTTGAGAGATCATTTGTTCGATCAGGGTTACAGGTGTC
GTTCATCTGCCAGTAGAGTAGCATGTTGTGGCCATTCTCTCCATAGAGACTGCCTTCGCTTCTATGGATTTGGGAACATG
GTAGCTTGCTTCCGATACGCTACTATAGATGTTCATTCGGTCTACCTTCCACCATCAGTTCTAAGTTTCAACTATGATAA
TCAGGACTGGATACAGAGAGAGATAGATAAGGTGGCAGAGAGAGCAGAGCTTCTGTTTTCTGAAGTACTAAATGCTATTA
GTCAAATTGCAGTGAAAGGTTCTAGGCGTCGAATTGGTCAACTCGAAGAACTGCTGCAAAGAGAGAAAGCAGAATTTGAG
GAAAATATGCAAAGGATGTTGCAGGGGGAGGTGAAGGAAGGCCAGCCTCTTGTGGACATTCTTGAACTATACCGGCTTCG
CAGACAGCTGATATTTCAGTCTTATATGTGGGATCACCGCTTGATTAATGCCTCAAATTTACAGAAGCTTGAGAGTAGTG
ATGACACAAAGCGAGAAGAAAATGAGAAACCACCCTTGGCTAAGAGCCAGACGCTCCCTGAGATGAATGCTGGGACAAAC
ACTCTTCTTGCTGGCTCAGAGGATAATCCGAATCCTGATAGTGGTTCTACTGGTGACACTGGCTCGTTAAATAAGGTTCA
GAAGGAAGCTGACGGAAATTTAGATTTGATTCAGGAAAAGGAAGATGAGGGAGAAGTTTCTCCCAGCAATACCTTACCTG
ATACTTCTGATCCTGTGGAAAATAAACTCGATGTTCGCAGGACACAGTCTGATGGCCATTTAGTGATGAAAAATCTTTCA
GCCACTCTTGATGCAGCATGGATAGGCGAACGTCAAACATCAGAGGATATTCCAGCAAATAATAAGATCTTGCTTCCTCC
TTCCTCCATGTCAATCTCAGAGGGGTTAAAGCCAATAGATCTCCCAGAACATCAAAAGGAATCCAAGGTAGCCTATCCAG
TTTCACCTGCTTTGCCAAGTAAAAATTATGAGAACTCAGAAGATTCTGTAAGCTGGTTAGGTATGCCATTCCTCAGTTTC
TACCGCTCCATCAACAAGAATTTTCTGCTTAGCTCTCAGAAGCTCGATACATTTGGCGAGCACAGCCCTGTCTATATTTC
ATCTTTTAGAGAGGCAGAGCTTCAAGGTGGACCAAGGCTACTTCTGCCTGTGGGTATAAATGATGTTGTTGTTCCGGTGT
ATGATGATGAGCCCACAAGTATGATCGCATATGCCTTGATGACACCCGAATATCAACGCCAAATTTCTGTTGAAGGGGAA
TCTCTAGTTTCATTTCCTTCTGAACTGAATATCCCTCGCCCAGTTGATGACACCATCTTTGACCCTAGCAGAAGCAATAG
TTCAGTGGATGAGAGTATACTTTCAATGTCCTCGTCTCTGCGTCTTGACCCACTTTCATACACAAAAGCTTTCAATGCTC
GAGTCTCATATGGAGAAGACGGCACTCTTGGGAAAGTGAAGTACACGGTTACTTGTTACTATGCTAAACGGTTTGAGGCG
TTGCGAGGTATATGTCTCCCTTCGGAACTTGAGTTCATAAGGTCTCTTAGCCGGTGTAAAAAATGGGGAGCTCAAGGTGG
AAAGAGCAATGTCTTCTTTGCTAAAACCCTGGACGATCGTTTCATCATCAAGCAAGTCACCAAGACAGAACTGGAATCGT
TCATCAAATTTGCACCTGCTTACTTCAAATACTTATCTGAGTCTATCAGCACGAAAAGCCCAACTTGCCTTGCAAAAATC
TTGGGAATCTATCAGGTCGCGACCAAGCAACTTAAGAGTGGTAAAGAAACAAAGATGGATGTTCTGATAATGGAGAATCT
TCTCTTTGGAAGAACTGTGAAGCGGCTTTATGACCTCAAAGGATCTTCCCGGGCGCGATACAATCCTGACTCTAGTGGGA
GCAATAAAGTCTTGCTGGATCAGAACTTGATTGAAGCAATGCCCACTTCTCCCATTTTTGTCGGTAACAAAGCAAAACGG
TTGTTGGAAAGAGCTGTCTGGAACGATACCGCCTTTCTTGCATTGGGTGATGTTATGGATTACTCGTTGCTAGTAGGCGT
GGATGAAGAAAAAAACGAGCTAGTTCTCGGGATCATCGATTTCTTAAGGCAGTACACATGGGACAAACATCTAGAGTCTT
GGGTGAAGTTTACAGGAATCTTAGGAGGCCCCAAGAATGAAGCACCAACAGTAATCTCGCCAAAGCAATACAAGAGAAGA
TTCAGAAAGGCGATGACTACTTACTTCCTCATGGTTCCTGACCAGTGGTCTCCCCCTGAAGTCATTGCTGATAACTCTAG
GTCTGATCAACCAGAAGAAACCTCTCAAACCGGCACGCAAGCAGAGTGA