Details for Chinese cabbage Locus Brara.A03196

Position : A01 ( 5`- 26749847 .. 26752272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03196

Protein [Map View]
MPPLGTFLKNYDTNCLSSKAADVATLQGYLSPLRSQSLIHFLRTPFRQHSTYTVLSKSANLDEAVVTLSSLSTPEPYTDA
LHACISAKSLHHGQKIHSLILSNPKLRRDPKLLTKLITLFSVCRRLDLARKLFHEAKDSTFLTEEVWAAMAIAFSRNGSP
REALAAYVDMLCSFVAPPGDFSISAALKACVEVKDLRFGRGVHAQIVKRRRKVDQVVENALLRLYMERGCFEDARKVFDG
MSERNIVTWNSLVSVLSKKVRVHEMFSLFRKMQEERIGFSWATLTTVLPACSRVAALLTGKEIHAQVVKSSERPDVPLLN
SLMDMYGKCGEVVYARRIFDGMLNKDLTSWNIMLNSYAINGSIQEEIKLFDTMIESGVAPDGITFVALLSGCSDTGLTEY
GVSLFERMKGEFRVSPALEHYACLVDILGRAGRIQEAVKVIETMPFKASGSVWGSLLNSCRLHGNVRVGEIAAQELFVLE
PHNPGNYVMVSNLYADAKMWDKVDKIREVMKQRGIKKEAGCSWVQVKDKIQIFVAGGGYEFRNSDEYKKLWLELQEAMER
LGYAPDTSLVLHDVDEATKVNWVCGHSERLATSYSLIHTGEGVPIRVTKNLRVCGDCHKWMKIVSQVTGRVIVLRDTKRF
HHFADGVCSCKDYW*

DNA
ATGCCTCCTCTAGGCACGTTCTTGAAAAATTACGACACAAACTGTCTCTCTTCCAAAGCTGCAGATGTTGCCACTCTACA
AGGTTATCTTTCCCCGCTAAGGTCTCAGAGTCTCATCCATTTCTTACGAACTCCATTCAGACAACACTCAACTTACACTG
TCCTCTCTAAATCCGCCAACCTCGACGAAGCCGTCGTCACTCTATCCTCACTCTCCACCCCGGAGCCTTACACAGACGCT
CTCCACGCGTGCATCTCCGCTAAATCCCTCCACCACGGCCAAAAGATCCACTCTTTAATCCTCAGCAACCCGAAACTCCG
CCGCGACCCCAAGCTACTCACCAAACTCATCACCCTCTTCTCCGTCTGCCGCCGCCTAGACCTCGCTCGCAAACTCTTCC
ACGAGGCCAAAGACTCGACCTTTCTCACCGAGGAAGTCTGGGCGGCGATGGCGATCGCCTTTTCAAGAAACGGGTCGCCG
AGGGAAGCTCTCGCCGCGTACGTGGACATGCTGTGTAGCTTCGTAGCGCCGCCCGGGGATTTCTCGATCTCCGCGGCGTT
GAAAGCGTGTGTCGAGGTTAAAGATCTTCGCTTTGGGAGAGGGGTGCATGCCCAGATCGTGAAGCGGAGGAGGAAGGTTG
ATCAGGTGGTGGAGAATGCGCTCTTGAGGCTTTACATGGAGAGGGGATGTTTTGAAGATGCGCGCAAGGTGTTCGATGGA
ATGTCTGAGAGGAATATTGTTACTTGGAACTCGCTTGTTTCGGTGCTAAGTAAGAAGGTTCGGGTTCATGAGATGTTTAG
TCTGTTTAGGAAGATGCAGGAGGAGAGGATTGGGTTTAGTTGGGCGACGCTGACGACGGTGTTGCCAGCTTGTTCGCGTG
TGGCTGCTCTTCTTACAGGGAAGGAGATTCATGCGCAGGTTGTGAAGTCTAGTGAGAGACCTGATGTTCCTTTGCTTAAC
TCGTTGATGGATATGTATGGGAAGTGTGGTGAGGTTGTGTACGCTAGGAGGATCTTTGATGGGATGTTAAATAAGGATCT
GACTTCATGGAACATTATGCTAAACTCTTACGCCATCAATGGGAGTATTCAAGAAGAGATTAAACTCTTTGATACGATGA
TAGAGTCAGGTGTTGCGCCAGATGGGATTACCTTTGTTGCTTTGTTATCTGGGTGTAGTGATACTGGCCTCACAGAGTAT
GGTGTAAGTTTGTTTGAGCGTATGAAAGGAGAGTTCAGAGTTTCACCTGCCTTGGAGCATTACGCTTGTTTGGTTGACAT
CTTGGGCCGAGCGGGTAGGATCCAAGAAGCAGTCAAGGTGATAGAAACAATGCCGTTTAAGGCAAGTGGATCCGTTTGGG
GATCACTTCTTAACTCTTGCAGGCTCCATGGGAATGTTAGAGTAGGAGAGATTGCAGCACAGGAGCTGTTTGTTCTTGAG
CCTCACAATCCAGGGAACTACGTTATGGTTTCTAACCTATACGCTGATGCAAAGATGTGGGACAAGGTGGATAAGATCCG
AGAGGTGATGAAACAGAGAGGGATCAAAAAGGAAGCTGGTTGCAGTTGGGTACAGGTTAAAGACAAGATACAAATCTTTG
TTGCGGGTGGTGGATATGAGTTTCGTAACTCAGATGAGTATAAGAAACTATGGTTAGAATTACAAGAAGCTATGGAAAGA
TTAGGTTATGCTCCTGATACAAGCCTGGTGCTTCATGATGTTGATGAAGCTACCAAGGTGAATTGGGTTTGTGGACATAG
TGAGAGGCTAGCGACAAGTTATTCTCTTATTCATACCGGTGAAGGGGTTCCGATTAGGGTTACTAAGAATCTGAGAGTAT
GTGGAGATTGCCATAAATGGATGAAGATTGTGTCGCAAGTAACTGGGAGAGTTATTGTTCTTAGAGATACAAAACGGTTC
CACCATTTCGCTGACGGTGTCTGCTCATGTAAAGACTACTGGTGA