Details for Chinese cabbage Locus Brara.A03194

Position : A01 ( 5`- 26739579 .. 26739725 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03194

Protein [Map View]
MAEFKIKFNKGHAFTSKCVSLVKEQRARLYILRRCATMLCCWYIHGDE*

DNA
ATGGCAGAATTCAAGATAAAGTTCAATAAAGGTCATGCCTTTACAAGCAAATGTGTTTCCTTGGTGAAGGAACAACGAGC
TCGTCTCTATATTCTCCGCCGTTGCGCCACCATGCTTTGCTGCTGGTACATCCATGGTGATGAATAG