Details for Chinese cabbage Locus Brara.A03192

Position : A01 ( 5`- 26712286 .. 26714399 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03192

Protein [Map View]
MKERRRSKVLISDHHSRSDSMAADRSKGVVRDEFATYAYILLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMIFSS
VLCFLLTKVLKIFKVEEGMTLEIYVTSVIPIGAMFAMTLWLGNTAYLYISVSFAQMLKAIMPVAVFVLGVAAGLEMMSCR
MLLIMSIISFGVLVASYGELNINWIGVVYQMGGVVGEALRLIFMEILVKRKGIKLNPISLMYYVSPCSAVCLFLPWIFLE
KSKMEGNSTWDFHFVVLTLNSLCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLVSALLFADTKLTVINLFGYAIAIA
GVAAYNNHKLKKEASPRVTTETPGDDSESIALVSQANTER*

DNA
ATGAAGGAGAGAAGACGAAGCAAAGTCTTAATCAGCGATCATCACAGTCGATCGGATTCAATGGCGGCGGATCGGAGCAA
AGGCGTTGTGAGAGACGAGTTCGCGACCTATGCTTACATTCTTCTCTACATCGCTCTCTCTAGCGGTCAAATCTTCTTCA
ATAAGTGGGTATTGTCATCTAAAGAAATAAACTTTCCTTATCCGCTTGGTTTGACTTTACTCCATATGATTTTCTCCTCT
GTCTTGTGCTTTCTTCTTACCAAAGTCCTCAAGATCTTCAAGGTTGAGGAAGGAATGACATTAGAAATATATGTTACCTC
AGTTATTCCAATAGGTGCCATGTTTGCCATGACCCTCTGGTTGGGCAACACTGCCTATCTCTACATTTCAGTTTCTTTTG
CCCAGATGCTGAAGGCTATAATGCCTGTTGCTGTGTTTGTTCTTGGGGTAGCTGCTGGGCTTGAGATGATGAGCTGCAGG
ATGCTTTTGATTATGTCTATCATAAGTTTCGGTGTTTTGGTAGCCTCTTATGGGGAACTGAACATCAACTGGATCGGTGT
AGTTTACCAAATGGGTGGAGTCGTTGGAGAAGCACTGCGGCTTATCTTCATGGAGATACTTGTCAAGAGGAAAGGCATTA
AGTTAAACCCAATCTCTCTCATGTACTATGTCAGCCCCTGCAGTGCTGTTTGCTTGTTTCTACCGTGGATCTTTCTAGAG
AAGTCGAAGATGGAGGGAAACAGCACATGGGACTTCCATTTCGTAGTATTGACTCTTAACTCGCTTTGTACATTCGCTCT
CAACTTGTCGGTGTTCTTGGTGATCTCTCACACGAGTGCTCTCACTATCCGAGTTGCTGGCGTTGTCAAGGACTGGGTGG
TTGTGTTGGTCTCAGCTCTTCTCTTTGCAGACACAAAACTCACTGTCATCAATCTTTTTGGTTACGCCATTGCTATTGCC
GGTGTAGCGGCTTATAACAATCATAAGCTGAAGAAAGAAGCTTCTCCTCGAGTAACCACCGAAACTCCAGGAGATGATAG
TGAATCTATAGCGCTGGTGTCACAGGCTAATACAGAGAGATGA