Details for Chinese cabbage Locus Brara.A03191

Position : A01 ( 5`- 26706479 .. 26712002 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03191

Protein [Map View]
MYTNRTSSGFRQSQACRFLSRVFLQERTVSYHLTNKCLLHLSFMRILDEINYYYPIAARIAIQAGAAGIIVSNHGARQLD
YVPATISALEEVSLPLTTPSSLSREAQFGKMEITNVTEYEAIAKEKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPR
ILIDVSKIDMTTTILGFKISMPIMVAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYV
YKNRKVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRT
LSWKDVQWLQTITSMPILVKGVITGEDARIAIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRR
GTDVFKALALGASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHITTEWDTPRPSARL*

DNA
ATGTATACAAACAGGACGTCCAGTGGCTTCAGACAATCACAAGCATGCCGATTCTTGTCAAGGGTGTTCTTACAGGAGAG
GACGGTGAGTTACCATCTCACAAACAAATGTCTTCTTCACTTAAGTTTCATGAGAATCCTTGATGAGATCAACTATTATT
ACCCTATTGCAGCAAGGATTGCGATTCAAGCTGGAGCAGCAGGGATCATTGTGTCAAACCATGGAGCTCGCCAACTTGAC
TATGTGCCAGCCACAATCTCAGCTCTTGAAGAGGTTTCTTTGCCACTCACAACACCTTCATCTCTCTCTCGCGAGGCTCA
GTTTGGAAAAATGGAGATTACAAACGTTACCGAGTATGAAGCGATTGCAAAGGAGAAGTTGCCTAAGATGGTATACGACT
ACTATGCCTCTGGTGCAGAGGACCAGTGGACTCTTCAAGAGAACAGAAACGCTTTCGCTAGGATCCTCTTTCGGCCTCGG
ATTCTGATTGATGTGAGCAAGATTGATATGACAACAACCATCTTGGGTTTCAAGATCTCCATGCCGATCATGGTTGCTCC
TACTGCCATGCAAAAGATGGCTCACCCGGAAGGGGAATATGCTACGGCTAGAGCTGCATCTGCTGCTGGAACCATCATGA
CACTGTCGTCTTGGGCTACTTCCAGTGTTGAAGAAGTTGCTTCCACAGGACCAGGGATTAGGTTCTTCCAGCTATATGTG
TACAAGAACAGGAAAGTGGTTGAGCAGCTCGTGAGAAGAGCCGAGAGGGCGGGGTTCAAAGCCATTGCTCTCACTGTAGA
CACCCCAAGGCTAGGCCGAAGAGAGTCTGATATCAAGAACAGATTCACTTTGCCTCCAAACCTGACATTGAAGAATTTTG
AAGGTCTCGACCTCGGAAAGATGGACGAGGCCAATGACTCTGGTTTGGCCTCATACGTTGCTGGCCAAATTGACCGTACC
TTAAGCTGGAAGGATGTCCAGTGGCTCCAGACAATCACTAGCATGCCGATTCTTGTCAAGGGTGTTATTACAGGAGAGGA
TGCAAGGATAGCGATTCAAGCTGGTGCAGCAGGGATCATTGTGTCGAACCATGGAGCTCGCCAGCTTGACTATGTTCCCG
CAACAATCTCAGCCCTTGAAGAGGTTGTCAAAGCGACACAAGGACGAATCCCTGTCTTCTTGGATGGTGGTGTTCGTCGT
GGCACTGACGTCTTCAAGGCACTTGCACTTGGAGCCTCAGGGATCTTTATTGGAAGACCAGTGGTGTTCTCACTTGCTGC
TGAAGGAGAGGCTGGAGTCAGAAAGGTGCTTCAAATGCTGCGTGATGAGTTCGAGCTGACCATGGCACTAAGTGGCTGCA
GGTCTCTCAAGGAAATCACCCGTAACCACATCACCACCGAATGGGACACTCCCCGCCCTTCAGCAAGGTTATAG