Details for Chinese cabbage Locus Brara.A03190

Position : A01 ( 5`- 26705933 .. 26706273 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03190

Protein [Map View]
MIGRRAGTNRIGMRRDDSYLTRFVDSVFSLFLLAEFELLFVMFFIIAYVIFKDLTARPEYNRILVEKPGGSDIWPF*

DNA
ATGATCGGCCGGCGTGCTGGAACTAATCGGATCGGTATGAGGAGGGACGACTCCTATCTGACTCGATTCGTTGACTCAGT
GTTTTCTCTCTTCCTATTAGCTGAGTTTGAGCTCCTGTTCGTGATGTTCTTCATTATAGCCTACGTCATCTTCAAAGATC
TGACGGCGAGGCCGGAGTACAATCGGATTCTGGTGGAGAAGCCCGGTGGATCTGACATATGGCCGTTCTAA