Details for Chinese cabbage Locus Brara.A03188

Position : A01 ( 5`- 26664351 .. 26666884 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03188

Protein [Map View]
MAAITENDPMAVITENVHTEKYIDVAKDVHEICVKSDSEKTIGDGIEKIAITSSKKESQLKPESELDMKNVVAMFKKLNP
LAKEFFPSYHNNTKKNNNTGKDNQIMPADDLVAKKNQFGEEFDHDLKKDDNNRKRRNGYSQGRRRLNGRISKAEREDSIR
RTVYVSDIDQSVSEEGLAGLFSNCGQVVDCRICGDPHSVLRFAFVEFADDQGAREALRLGGTMLGYYPVRVLPSKTAILP
VNPTFLPRSEDEREMCSRTIYCTNIDKKVSQADVRNFFESACGEVTRLRLLGDQLHSTRIAFVEFALADIALRALSCSGM
VVGSQPIRVSPSKTPVRPRITQPSSTN*

DNA
ATGGCTGCGATCACTGAGAATGATCCAATGGCTGTGATCACTGAGAATGTACACACTGAGAAGTACATTGATGTTGCCAA
AGATGTTCATGAAATTTGTGTCAAAAGCGATAGCGAAAAGACCATTGGTGATGGAATTGAGAAAATCGCGATCACGAGTT
CTAAAAAAGAGTCTCAGCTCAAACCTGAATCCGAGTTAGATATGAAGAATGTTGTAGCGATGTTCAAGAAACTGAATCCT
TTGGCAAAGGAGTTTTTCCCTTCTTACCACAACAACACCAAGAAAAACAATAATACTGGGAAAGACAATCAAATTATGCC
GGCTGACGATTTGGTGGCTAAAAAGAATCAATTCGGTGAAGAATTTGATCATGATCTCAAGAAGGATGACAATAACCGGA
AGAGAAGAAACGGTTACAGCCAAGGGAGGAGGAGGTTAAATGGAAGAATTTCTAAGGCTGAGAGAGAGGATAGTATTAGA
AGAACAGTATATGTTTCTGACATTGACCAGAGTGTGTCTGAGGAGGGTCTTGCTGGCTTGTTTAGTAACTGTGGACAAGT
TGTTGACTGTCGAATTTGTGGGGATCCACATTCAGTTCTTCGATTTGCATTTGTCGAGTTTGCTGATGACCAGGGTGCAA
GGGAAGCTTTAAGGCTTGGTGGAACTATGCTTGGGTACTACCCGGTGAGGGTTTTACCCTCCAAAACTGCTATTCTTCCA
GTTAATCCCACATTTCTTCCCAGGTCAGAGGATGAAAGGGAGATGTGTTCAAGGACAATCTATTGCACAAATATTGACAA
GAAGGTTTCTCAAGCTGATGTGAGAAACTTCTTTGAGTCGGCATGTGGTGAGGTAACTCGCCTAAGGCTTCTCGGCGATC
AACTGCATTCAACTCGCATAGCTTTTGTTGAATTTGCTCTGGCAGATATAGCACTTAGGGCGCTCAGTTGCAGCGGGATG
GTCGTTGGATCCCAACCAATTAGGGTAAGTCCTTCAAAGACACCGGTGAGGCCACGAATCACTCAACCATCTTCCACAAA
CTAG