Details for Chinese cabbage Locus Brara.A03184

Position : A01 ( 5`- 26633682 .. 26637108 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03184

Protein [Map View]
MECSVFHHVVIVLMLLWLLSYLNRSHALFYFLALVYLYLVHERYVMRLRKKLQFEERKQANQKRVLSDSESVRWLNHAVE
KIWPICMEQIASQKILRPIIPWFLDKYRPWTAKEALIQHLYLGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLTADDMSA
ILAVKLRKRLGFGMWTKLHLTGMHVEGKVLVGVKFLRRWPFLGRLRVCFAEPPYFQMNVKPIFTHGVDVTVLPGIAGWLD
KLLSIAFEQTLVEPNMLVVDMEKFVSPQSGENWFFVDEKEPVAHALVEVVEASDVKPSDLNGLSDPYVKGQLGAYRFKTK
ILKKTLSPKWQEEFKIPILTWDSPNILNIEVQDKDRFSDDSLGDCSVNIAEFRGGERNDMWLPLQNIKMGRLHLAITVTE
EEAKVDDDDDPFEGATISKEDMWASFANDDANRGPFSSVVSDKSPRVRDNLEPINIEGQEETGIWVHQPGTEVSQIWEPR
KGKSRCVDNNIRGVTLEASTGSNESSSPDENQEGKNKARSVGKGLKKVFHRNGKKEESGNVEEDVRSPRINLKALNRKDV
GVKYIVEDRLSGPLTGRSPRGESFGSEDAQNKGHMKDVAKSILKHAEKSARHIKHAFSRKGSRKSRDDECSTVPENESVF
GSECQFEYSDDDDTADGSVQGTPRKAKDEGKGVRAGEDGLVNTSANSKEDSRGVTHMDASAGAEKVSTPKKVQ*

DNA
ATGGAGTGTTCGGTGTTCCATCACGTGGTGATTGTGTTGATGTTACTTTGGCTTCTCTCTTACTTGAATCGATCACACGC
CCTTTTCTATTTCCTCGCTCTCGTTTACCTCTACTTGGTTCATGAGCGTTACGTGATGAGGTTGAGGAAGAAGTTGCAGT
TTGAAGAGAGGAAGCAAGCTAACCAGAAACGGGTTCTATCTGATTCTGAATCGGTGCGGTGGTTGAATCATGCCGTGGAG
AAGATATGGCCTATTTGTATGGAACAGATTGCTTCTCAGAAGATTCTTCGTCCCATCATACCTTGGTTCTTGGACAAGTA
TAGACCTTGGACCGCGAAAGAGGCTTTGATACAACATCTCTATTTGGGAAGAAACCCTCCTTTGTTGACTGATATAAGAG
TGCTAAGGCAATCTACTGGTGATGATCACTTGGTGCTGGAACTTGGAATGAACTTCCTCACAGCAGATGATATGAGCGCA
ATACTCGCTGTGAAGTTGAGGAAAAGACTTGGGTTTGGGATGTGGACCAAGTTACATCTCACAGGGATGCATGTTGAAGG
AAAGGTGTTGGTTGGAGTGAAGTTCCTTCGTAGATGGCCGTTTCTGGGGCGGTTACGCGTCTGTTTTGCAGAGCCGCCTT
ATTTCCAAATGAATGTGAAACCAATCTTCACTCACGGAGTTGATGTTACTGTCCTTCCAGGGATTGCAGGATGGCTTGAC
AAACTCTTGTCTATTGCATTTGAGCAGACTCTTGTTGAGCCAAATATGCTTGTAGTTGATATGGAGAAGTTTGTTAGCCC
ACAATCAGGAGAGAATTGGTTCTTTGTTGATGAGAAAGAACCAGTTGCACACGCTCTTGTTGAAGTCGTTGAAGCATCTG
ATGTTAAACCATCAGATCTAAATGGTTTATCTGATCCTTACGTGAAAGGCCAGCTCGGCGCATACAGATTCAAAACCAAG
ATACTAAAGAAAACACTCTCTCCCAAATGGCAAGAAGAGTTCAAGATCCCAATCTTGACGTGGGACTCTCCAAACATCCT
CAACATCGAAGTCCAAGACAAAGACCGGTTCAGCGACGACAGCCTCGGCGACTGTTCAGTCAACATCGCAGAGTTTAGAG
GTGGGGAGAGAAACGACATGTGGCTGCCTCTCCAGAACATCAAGATGGGGAGGCTCCACCTCGCTATTACAGTAACCGAG
GAGGAAGCAAAGGTGGATGATGATGATGATCCGTTTGAAGGAGCGACGATAAGTAAAGAAGACATGTGGGCTTCCTTTGC
TAATGATGATGCAAATAGAGGCCCATTCTCTTCGGTGGTGTCTGATAAGTCTCCGAGAGTTAGGGATAATCTTGAACCGA
TTAACATTGAAGGACAAGAAGAGACTGGGATATGGGTGCATCAGCCAGGGACTGAAGTCTCTCAGATATGGGAGCCAAGA
AAAGGCAAGAGTCGATGCGTTGACAACAACATACGTGGAGTTACTCTTGAGGCTTCTACTGGTAGTAATGAAAGCAGCAG
TCCTGATGAGAACCAGGAAGGGAAGAACAAAGCGAGGTCTGTTGGTAAAGGATTGAAGAAAGTGTTTCATAGGAATGGGA
AGAAGGAAGAGTCTGGGAACGTGGAGGAGGATGTGAGGTCTCCTAGGATCAACTTGAAGGCGTTGAATCGAAAGGATGTT
GGTGTTAAGTACATAGTTGAAGACCGTTTGTCTGGGCCTTTGACGGGGAGAAGTCCAAGAGGTGAGAGCTTTGGCTCTGA
GGATGCTCAGAACAAGGGACATATGAAGGATGTTGCCAAGAGCATTCTGAAACACGCTGAGAAGTCGGCGAGGCATATAA
AGCACGCGTTTTCGCGTAAAGGGTCGAGGAAGTCGAGAGATGATGAGTGCTCAACGGTTCCTGAGAATGAGTCTGTGTTT
GGTTCAGAATGTCAGTTTGAATATTCTGACGATGATGATACTGCAGATGGCAGTGTGCAGGGGACACCAAGGAAAGCAAA
AGATGAAGGTAAAGGTGTGAGGGCAGGAGAAGATGGTCTTGTGAATACATCAGCAAACTCTAAAGAAGATTCTAGAGGTG
TTACACATATGGATGCTTCTGCTGGAGCTGAGAAAGTCTCTACGCCAAAAAAAGTCCAATGA