Details for Chinese cabbage Locus Brara.A03178

Position : A01 ( 5`- 26612905 .. 26614842 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03178

Protein [Map View]
MTVVFLRIQIQKISIGTLRLIPRNLSTIKPSPLSSLYSTLSSRIEEHPKRYKHHNVATCIAALQRCAHRNDAVSGGELHG
FMVRKGLLEDSPRAVTSLVNMYAKCGLMRRAISVSGGSERDVFAYNAIISGFVVNGFPFDAVEMYREMRANGILPDKYTF
PSLLKGSDAMEVSDVRTVHGLAFKLGFDSDCYVGSALVCSYLKFRVVEDAQKVFDELPERDDSVLWNALVIGYSQIFKFE
DALRVFSQMREEGVALSRHTVTGVLSAFTVLADVDNGRSIHGLAVKTGFDSGTVVSNALIDMYGKSRWLEEAVKIFEAMD
NERDIFTWNSVLCVHDYCGDHDGALAMFNRMLCSGIRPDLVTLTTVLPTCGRLAALNQGREIHGYMIVNGLLNRNSNDEF
INNSLMDMYAKCGDLRDAQTVFDSMRSKDSASWNIMINGYGVQSCGELALDMFSRMCEAGVRPDEITFVGLLQACNHSGF
VSDGKRFLAQMETVYNVIPTSDHYTCVIDMLGRAGKLQEAYKLAVTMPVGDNPVVWRSILASCRLHGNNIGLGELAVKRL
YELEPEHSGAYILMSNMYMETGGYERVLALRDAMKKQNMKKTAASSWIEVKHEIHTFFNSDKTHPEYESIEACLSPLTSH
ILGGH*

DNA
ATGACCGTCGTCTTCCTTCGAATCCAGATTCAAAAAATTTCCATCGGAACTCTGAGGCTAATCCCACGAAACCTCTCCAC
GATAAAGCCTTCTCCTTTATCATCTCTCTACTCCACACTCTCTTCCCGAATCGAAGAACACCCGAAGAGATACAAGCACC
ACAATGTCGCTACCTGCATCGCCGCATTGCAACGCTGCGCGCACCGCAACGACGCCGTTTCCGGCGGGGAGCTACACGGC
TTCATGGTCCGGAAAGGGCTTCTCGAAGACTCCCCTCGCGCCGTCACCAGCCTCGTCAACATGTACGCTAAGTGCGGTCT
CATGCGGCGAGCGATCTCCGTCTCTGGTGGATCCGAGCGAGACGTGTTTGCCTATAACGCGATTATCTCTGGGTTTGTTG
TGAATGGGTTTCCTTTTGATGCTGTGGAGATGTATAGAGAGATGAGAGCTAATGGAATTTTACCCGATAAGTATACGTTT
CCTAGTTTGCTTAAAGGAAGCGATGCCATGGAGGTTTCTGATGTTAGGACGGTTCATGGATTAGCGTTTAAACTTGGGTT
TGATTCGGATTGTTATGTAGGGAGTGCGTTAGTGTGTTCTTATTTAAAGTTTAGGGTAGTGGAGGATGCGCAGAAGGTGT
TCGACGAATTGCCTGAGAGAGACGACAGTGTGCTTTGGAACGCTTTGGTTATTGGGTATTCTCAGATATTTAAGTTTGAG
GATGCTTTGAGAGTCTTTAGTCAAATGCGTGAAGAAGGTGTTGCCTTGAGTAGGCATACAGTCACCGGCGTCTTGTCAGC
GTTCACTGTGTTAGCGGATGTTGACAACGGTAGATCGATCCACGGCCTCGCGGTGAAAACGGGGTTTGATTCTGGAACCG
TTGTGTCGAATGCGTTGATTGATATGTATGGAAAGAGTAGGTGGCTAGAGGAAGCGGTTAAGATCTTTGAAGCGATGGAT
AACGAGAGAGATATCTTTACGTGGAACTCTGTTTTATGTGTTCATGACTACTGTGGTGATCATGACGGAGCTTTAGCTAT
GTTCAACAGGATGCTTTGTTCCGGAATCCGACCTGATCTCGTTACGTTGACGACAGTTCTCCCCACTTGCGGTCGTTTAG
CTGCGTTGAACCAGGGAAGAGAGATTCATGGATACATGATCGTCAACGGACTCTTAAACCGAAACTCCAATGATGAGTTC
ATCAACAACTCCTTGATGGACATGTACGCGAAATGCGGGGACTTGAGAGATGCGCAGACGGTTTTCGACTCGATGAGGAG
TAAAGACTCGGCTTCTTGGAACATTATGATTAACGGTTACGGTGTCCAGAGCTGCGGCGAGCTAGCTTTGGATATGTTCT
CGCGTATGTGCGAAGCAGGTGTCAGACCTGATGAGATCACATTCGTTGGGCTGCTACAAGCATGTAACCACTCAGGCTTT
GTTAGCGACGGGAAAAGGTTCCTGGCGCAGATGGAGACGGTATACAACGTTATTCCAACGAGTGATCACTACACTTGTGT
GATAGACATGCTTGGCCGTGCAGGGAAGCTACAAGAAGCATATAAGTTAGCAGTAACAATGCCTGTGGGGGATAATCCTG
TAGTCTGGAGGTCAATATTAGCATCTTGTCGTCTCCACGGGAACAACATAGGCCTGGGGGAATTGGCTGTAAAGCGGTTA
TATGAGCTAGAGCCAGAGCATAGCGGCGCTTATATATTAATGTCTAATATGTATATGGAAACCGGTGGATACGAGCGAGT
TTTGGCCCTTAGAGACGCAATGAAAAAACAGAATATGAAGAAGACAGCAGCTAGTAGCTGGATTGAGGTCAAGCATGAGA
TTCACACGTTCTTTAACAGCGATAAGACTCACCCGGAATATGAATCTATCGAGGCTTGTTTAAGCCCGTTGACTTCTCAT
ATATTAGGTGGTCATTAG