Details for Chinese cabbage Locus Brara.A03175

Position : A01 ( 5`- 26608002 .. 26609190 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03175

Protein [Map View]
MEALWKLEDKLKLTTKDAVVILVGTAAAVTLLCIAAAFLNRNSRGKQVADAEWAFVESRTMDQKRNCKWSKVKRRLMGSF
CWSSAAKWMEMETRPPPQRTLLAVKERSLNAVDQVWQRPILMGEKCELPRFSGLILYDERGDPIQHSPSQEEVKQTPLVR
TTLRDLL*

DNA
ATGGAAGCCTTGTGGAAGTTGGAGGATAAACTGAAGCTAACAACGAAAGACGCGGTAGTGATCTTGGTCGGAACAGCGGC
TGCAGTAACGCTCCTCTGCATAGCCGCAGCGTTTCTCAACCGCAATTCTCGAGGAAAGCAAGTAGCAGACGCGGAGTGGG
CGTTTGTTGAGTCAAGAACAATGGATCAAAAGAGGAACTGTAAGTGGAGCAAAGTGAAGAGAAGGTTGATGGGCTCGTTC
TGTTGGAGCTCTGCAGCTAAGTGGATGGAGATGGAAACACGACCGCCGCCGCAGCGGACATTGCTTGCGGTTAAAGAAAG
GAGTCTTAATGCGGTTGATCAGGTTTGGCAGCGACCGATTCTGATGGGTGAGAAATGTGAACTTCCACGGTTTAGTGGTT
TAATATTGTATGATGAACGTGGCGATCCGATTCAGCATTCTCCATCTCAAGAAGAAGTTAAACAGACTCCTCTGGTAAGA
ACAACTTTGAGAGATTTGCTTTGA