Details for Chinese cabbage Locus Brara.A03173

Position : A01 ( 5`- 26592169 .. 26595035 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03173

Protein [Map View]
MTTYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIASDDLVSYLLITEN
IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPY
SATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFMLLAMNGKPLPIHGDGSNVRSYLYCEDVAEAFEVVL
HKGEVNHVYNIGTTRERRVIDVANDISKLFGTDPDSTIQFVENRPFNDQRYFLDDQKLKKLGWSERTTWEEGLRKTMEWY
TENPDWWGDVTGALLPHPRMLMMPGDRLCDNCDDEHKDVADGNQTFTVVTPSGDNKTPFKFLIYGKTGWLGGLLGKLCEK
QGIAYEYGKGRLEDRASVMADIRSVKPTHVFNAAGVTGRPNVDWCESHKTETIRANVAGTLTLADVCRENGLLMMNFATG
CIFEYDAAHPEGSGIGFKEEDKPNFTGSFYSKTKAMVEELLREYDNVCTLRVRMPISSDLNNPRNFITKISRYNKVVNIP
NSMTILDELLPISIEMAKRNLRGVWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTLEEQAKVIVAARSNNEMDGAKLSK
EFPEMLSIKDSLIKYVFEPNKRT*

DNA
ATGACTACATATAAGCCCAAGAACATCCTCATAACCGGAGCAGCCGGTTTCATCGCCTCCCACGTGGCCAACAGGCTAGT
CCGCACCTACCCCGACTACAAAATCGTGGTCCTCGACAAGCTCGACTACTGCTCCAACCTCAAAAACCTTAACCCTTCCA
AATCCTCACCCAACTTCAAGTTCGTCAAGGGCGACATCGCCAGCGACGACCTCGTCAGCTACCTTCTCATCACCGAGAAC
ATCGACACCATCATGCACTTCGCCGCTCAGACCCACGTCGACAACTCCTTCGGCAACAGCTTCGAGTTCACCAAGAACAA
CATCTACGGCACGCACGTTCTTTTAGAAGCTTGCAAAGTCACTGGACAACAGATCAGGAGGTTTATCCACGTGAGTACAG
ATGAGGTCTACGGAGAGACTGATGAGGATGCTTCTGTTGGGAACCATGAAGCTTCTCAGCTGCTTCCGACGAATCCTTAC
TCCGCTACTAAAGCTGGTGCTGAGATGCTTGTCATGGCGTATGGGAGATCGTATGGTTTACCTGTTATAACCACGCGTGG
GAATAATGTTTATGGTCCGAATCAGTTTCCTGAGAAGTTGATACCTAAGTTCATGTTGTTGGCTATGAATGGGAAGCCGC
TTCCTATCCATGGGGATGGATCTAATGTTAGGAGTTATTTGTATTGTGAAGATGTTGCTGAGGCGTTTGAGGTTGTTCTA
CACAAAGGTGAAGTTAACCATGTTTATAATATTGGGACGACGAGAGAGAGGAGAGTGATTGATGTGGCGAATGACATCTC
CAAGCTCTTTGGAACTGACCCTGACTCTACAATTCAGTTTGTGGAGAACCGGCCGTTTAATGACCAGAGGTACTTCCTCG
ACGACCAGAAGCTGAAGAAGTTGGGATGGTCGGAACGAACCACTTGGGAGGAAGGGCTGAGGAAGACGATGGAGTGGTAC
ACTGAGAACCCTGATTGGTGGGGAGATGTTACTGGAGCGCTCCTGCCTCATCCAAGGATGCTGATGATGCCTGGTGATAG
ACTCTGCGATAACTGTGACGACGAGCACAAGGATGTTGCAGATGGTAATCAGACGTTCACTGTGGTTACTCCTTCTGGAG
ACAACAAGACTCCCTTTAAGTTTCTTATATACGGCAAGACCGGGTGGCTTGGTGGTCTTCTAGGGAAGCTGTGTGAGAAG
CAAGGGATTGCATACGAGTATGGGAAAGGGAGACTAGAGGACAGAGCTTCTGTAATGGCGGATATTCGCAGTGTCAAACC
TACTCATGTTTTCAATGCCGCCGGTGTAACGGGCAGACCCAATGTTGACTGGTGTGAGTCTCACAAAACCGAGACTATCC
GAGCCAATGTTGCTGGTACTTTGACTCTAGCAGATGTGTGCAGAGAGAATGGTTTATTGATGATGAACTTCGCTACTGGT
TGTATATTTGAGTACGACGCTGCGCATCCAGAAGGCTCAGGGATTGGCTTCAAGGAAGAAGACAAACCAAACTTCACCGG
CTCTTTCTACTCAAAGACAAAGGCAATGGTGGAGGAGCTTCTAAGAGAATACGACAACGTGTGCACGTTGAGAGTGCGGA
TGCCAATCTCATCAGACTTGAACAACCCAAGGAACTTCATCACGAAGATCTCGCGGTACAACAAAGTGGTGAACATCCCG
AACAGCATGACCATACTCGACGAGCTCTTACCAATCTCGATCGAGATGGCGAAGAGGAACCTGAGGGGGGTTTGGAACTT
CACCAATCCGGGAGTGGTGAGCCACAACGAGATACTAGAGATGTACAAGAGCTACATCGAGCCGGGTTTCAAGTGGTCCA
ACTTCACTTTGGAGGAACAGGCTAAGGTCATTGTGGCGGCAAGGAGCAACAACGAGATGGATGGTGCCAAGCTTAGTAAG
GAGTTTCCGGAGATGCTTTCCATCAAAGATTCGTTGATCAAATACGTCTTTGAACCCAACAAGAGAACGTAA