Details for Chinese cabbage Locus Brara.A03168

Position : A01 ( 5`- 26550536 .. 26552329 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03168

Protein [Map View]
MASLPPLIFFFTLHSLSTLSLAVHHETTRSRFKPPHFSPLLISPPSQNLTSPTPYLEVKKPPVLPDSPPPPCSHHILHHE
FAYTYGKPPVLTNYTLPSHCPSLEFSKIVLEFKSTCKGRQFDRIFGVWLDGVELLRSCTAEPRQNGIVWSVQKDVTRYHS
ILVKNQTQTLAVYLGNLIDKTYTGVYHVDVIFHYYPSSSGYISPRADMILPVSRKLPLNAGLWFEIVNSSYKEVVIPRNV
YKAVLEVYVSFHEKDEFWYGNLYNDYVTANNLSSPGNGPFREVVVTLDGEVAGAVWPFPVVFTGGINPSLWRPITAIGSF
DLPSYDIEMTPFLGGLLDGEAHKVGFSVTNALNVWYIDANLHLWLDKEKEVVEGKVLEVRRSSLEVSYASDFKGLNGNFT
TKAKRSVYSTGLVKSSHGDIITSASQEFTYVNKMVLGKDGNMQIIDQLIQADDRVNAKRESREIYAAKSIKSFPFYLYSD
YLEGENHTSKVVANVTMGFNEERSWSDDDGLMRTFKSKLENKQEAQGVMVVKNNLVVSGYGGTQQMYNYVGSDQCYFRNI
SSFNYTILYDKVEAVCKKKTLKPTPRLEHLTTQPLLA*

DNA
ATGGCCTCTCTTCCTCCACTCATCTTCTTCTTCACCCTCCACTCTCTTTCCACCCTCTCCCTCGCCGTTCACCATGAAAC
AACCAGATCGCGTTTCAAACCACCACATTTCTCCCCTCTCCTCATCTCTCCTCCATCCCAAAACCTCACCTCACCTACTC
CCTACCTCGAGGTCAAAAAGCCTCCCGTCCTCCCCGATTCTCCGCCACCACCGTGCTCGCACCACATCCTCCACCACGAG
TTCGCCTACACCTACGGCAAACCTCCTGTCCTCACCAACTACACTCTCCCCTCTCACTGCCCTTCCCTCGAATTCTCCAA
GATCGTCCTCGAATTCAAATCCACTTGCAAAGGTAGACAGTTCGACCGCATCTTCGGCGTTTGGCTCGATGGCGTCGAGC
TTCTCCGCAGCTGCACCGCCGAGCCTAGACAAAACGGCATTGTATGGTCTGTCCAAAAAGACGTGACTAGGTATCACTCT
ATCCTCGTCAAGAACCAAACTCAAACTCTCGCTGTCTACCTCGGTAACCTAATAGATAAAACCTACACCGGCGTCTACCA
CGTGGATGTCATCTTCCATTACTACCCTTCTTCTTCTGGTTACATCTCTCCTCGAGCTGATATGATCCTCCCCGTTTCAA
GAAAACTTCCTTTAAACGCTGGACTATGGTTTGAGATCGTTAATTCTAGTTACAAGGAAGTAGTGATCCCTAGGAATGTG
TATAAAGCTGTTCTCGAGGTTTATGTTTCTTTCCACGAGAAAGATGAGTTTTGGTATGGGAATCTTTATAATGACTATGT
TACCGCAAACAATCTAAGTTCTCCTGGTAACGGACCTTTTAGAGAAGTTGTGGTTACTCTTGACGGCGAAGTTGCCGGTG
CGGTTTGGCCTTTCCCCGTTGTTTTCACCGGTGGGATTAATCCTTCGCTGTGGAGACCGATCACAGCTATTGGCTCTTTT
GATTTGCCGAGTTATGATATCGAGATGACGCCTTTCTTGGGGGGTTTGTTGGATGGAGAGGCTCATAAGGTGGGGTTTAG
TGTGACTAATGCGTTGAATGTTTGGTATATAGATGCGAATTTGCATCTTTGGTTGGATAAGGAGAAGGAGGTAGTTGAAG
GGAAGGTCTTGGAGGTTAGGAGAAGTTCTCTGGAGGTTAGTTATGCCTCTGACTTCAAGGGTTTGAATGGTAACTTCACA
ACCAAGGCGAAAAGATCGGTTTATTCGACAGGGCTGGTGAAGTCCTCTCATGGGGACATTATAACCAGTGCTAGTCAGGA
GTTTACCTATGTAAACAAAATGGTTTTAGGTAAAGATGGGAATATGCAGATTATAGATCAGTTGATCCAAGCTGATGACC
GTGTCAACGCCAAGAGAGAGTCCAGAGAAATTTACGCGGCGAAATCCATCAAGAGTTTTCCTTTTTACCTATACTCTGAC
TATTTGGAGGGAGAGAATCACACGTCGAAGGTGGTTGCGAATGTCACGATGGGATTCAATGAGGAGAGATCATGGAGTGA
CGATGATGGATTGATGAGAACGTTCAAGAGTAAGCTGGAGAATAAGCAAGAAGCGCAAGGGGTTATGGTGGTGAAGAATA
ACTTGGTGGTCAGTGGATATGGGGGGACGCAACAAATGTATAACTATGTTGGAAGTGACCAGTGTTACTTCCGGAACATT
AGTAGCTTCAACTATACCATTCTATATGATAAGGTTGAAGCTGTTTGCAAGAAGAAAACACTGAAGCCGACGCCACGGCT
CGAGCATCTGACCACACAGCCGTTGTTGGCTTGA