Details for Chinese cabbage Locus Brara.A03166

Position : A01 ( 5`- 26519818 .. 26521090 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03166

Protein [Map View]
MGSGWLLRSLICFKAEKHKKSNQSNVHSETLNRVKPVESSSASTTLTVEIAATRIQKAFRAYKARKRLCSLKSARRFNAL
IQGHTVRNQTSIALNVMHSWYDIQSQIRARRMYMVTQGRLQNKRLENRLKLEIKLHEIEVEWCGGSETMEEILARIQQKE
EATVKRERAMAYAFSHQWRANATQYLGQASFNLDKENWGWSWKERWIAARPWEIRAQCQVTKPIKPATKPEKLSAPNVST
KKTSTKPGLPNTKEAAKSRKPGSG*

DNA
ATGGGATCTGGATGGTTGCTCCGGTCTCTCATATGTTTCAAAGCAGAAAAACATAAAAAATCAAACCAAAGCAACGTACA
TTCTGAAACATTAAACCGTGTCAAACCGGTCGAATCAAGCTCAGCTTCCACTACTCTTACCGTAGAGATCGCTGCTACTC
GCATTCAAAAGGCTTTTAGAGCATACAAGGCGAGAAAAAGACTATGCAGCTTGAAGAGCGCAAGGAGATTTAACGCACTG
ATCCAAGGCCATACGGTGAGGAACCAAACTTCGATTGCACTCAATGTGATGCATTCTTGGTACGATATACAGAGTCAGAT
CAGAGCACGGCGTATGTATATGGTGACACAAGGTAGACTCCAGAACAAAAGATTGGAGAATCGGTTGAAGCTGGAGATCA
AGCTTCATGAGATAGAAGTTGAATGGTGTGGAGGGTCTGAAACAATGGAGGAGATTCTTGCGAGGATACAACAGAAAGAA
GAAGCTACAGTGAAGCGTGAACGTGCAATGGCTTACGCCTTTTCTCACCAGTGGAGAGCTAATGCTACACAGTATCTAGG
TCAAGCCTCGTTTAACCTAGACAAAGAAAACTGGGGATGGAGTTGGAAAGAACGGTGGATAGCAGCTCGACCTTGGGAGA
TTAGGGCCCAATGTCAAGTCACTAAACCGATCAAACCGGCTACAAAACCGGAGAAATTATCAGCACCCAATGTGAGCACA
AAGAAAACATCCACTAAACCGGGTTTGCCAAACACCAAGGAAGCTGCAAAATCCAGAAAGCCCGGTTCTGGATGA