Details for Chinese cabbage Locus Brara.A03160

Position : A01 ( 5`- 26490504 .. 26491800 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03160

Protein [Map View]
MDPTLNDHQELEQIEAIDDLLEDFWFFDNLLDRRSRILRYCHSDPYPLSPSSSSTCPKPEFSKIGDSDSDKKLLNAPTEG
DSVPLPCIVNKEGGREPEKINKMRRQFSEKLRVHERRAYLQKKEPMVREKGNRESSKKNRTGINSSCNNNSVQCCSMGGS
LQRTQTLPSYIGREDVGNEFQDQEIDDSRMGFLIREAIASSSSEFTPTKQNTPKSSSIPRPRPPRHSRSEEAIQEMVVKS
QRKPNDKTLRKTLSSVDTKELLMLKDLDIDESETKQEKDEEEQRRIPRAAMKGRSAAVVGQPIPVWVPKESRRDMKAQIK
FWARTVASNVRQEC*

DNA
ATGGATCCTACTTTGAATGATCATCAAGAGTTGGAACAAATCGAAGCTATTGATGATCTTCTTGAAGATTTCTGGTTCTT
TGATAACTTACTTGACAGAAGATCAAGAATCTTGAGGTATTGTCATTCAGATCCTTACCCTCTTTCTCCTTCTTCCTCTT
CCACTTGTCCGAAACCCGAATTCTCAAAAATTGGAGATTCGGATTCAGACAAGAAGCTTCTAAATGCTCCCACCGAGGGA
GACTCGGTTCCACTACCGTGTATAGTGAATAAAGAAGGTGGAAGAGAGCCTGAGAAGATAAACAAGATGAGAAGGCAGTT
CTCTGAGAAGCTTAGGGTTCACGAACGAAGAGCTTACTTGCAAAAGAAGGAACCTATGGTTCGAGAGAAGGGAAATAGAG
AAAGCTCTAAAAAGAACAGAACTGGTATTAATAGTAGTTGTAATAACAATAGTGTCCAGTGTTGTTCGATGGGAGGGAGT
TTACAGAGAACTCAGACGTTACCTAGTTACATAGGAAGAGAAGATGTCGGAAATGAGTTTCAAGATCAAGAGATTGACGA
TTCGAGGATGGGTTTCTTGATCCGTGAAGCCATCGCTAGCTCTTCTTCTGAGTTTACTCCAACAAAACAAAACACACCAA
AGAGTTCAAGCATCCCAAGGCCTAGACCACCGAGACACTCGAGATCAGAAGAAGCTATTCAAGAAATGGTCGTCAAGTCA
CAAAGAAAACCAAATGATAAAACGCTGCGTAAGACGTTAAGCAGCGTCGATACGAAAGAGCTTCTGATGTTGAAAGACTT
GGACATTGATGAGTCGGAGACGAAACAAGAAAAAGATGAGGAAGAACAGAGGAGGATCCCACGCGCAGCTATGAAAGGCC
GGTCTGCAGCGGTGGTGGGTCAGCCGATTCCAGTTTGGGTTCCAAAGGAGTCGAGAAGAGACATGAAAGCTCAGATCAAG
TTTTGGGCTCGAACCGTTGCAAGTAATGTTCGACAAGAATGCTGA