Details for Chinese cabbage Locus Brara.A03153

Position : A01 ( 5`- 26457321 .. 26458278 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03153

Protein [Map View]
MEKSQSWSYVKDKAIVSNLAEQEWENSMDGEEEDAGDEDKRKRVMERARGTNTDRVPPRLCQVHRCTANLTEAKQYYRRH
KVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAKRSCRMRLAGHNERRRKVSGDSFGERSGRRGFSSQLIQTQERN
KVDIKFPMANTSFKRP*

DNA
ATGGAGAAATCACAAAGCTGGAGTTACGTGAAAGACAAGGCTATAGTCTCCAACCTTGCTGAACAAGAATGGGAGAATAG
CATGGATGGAGAAGAGGAGGATGCAGGAGATGAAGACAAAAGGAAGAGAGTGATGGAGAGAGCTAGGGGTACTAACACAG
ACCGTGTTCCACCGCGGCTATGCCAGGTCCATAGGTGCACTGCTAATTTAACTGAAGCCAAGCAGTATTACCGCAGACAC
AAAGTCTGTGAAGTTCATGCAAAGGCATCTGCTGCAACTGTTTCAGGCGCCAAGCAACGTTTTTGTCAACAATGCAGCAG
GTTTCATGAGCTACCAGAGTTTGATGAAGCTAAAAGAAGTTGCCGGATGCGCCTAGCTGGACACAATGAGAGGAGAAGGA
AGGTTTCTGGTGACAGTTTCGGCGAAAGGTCAGGCCGAAGAGGGTTTAGCAGTCAACTGATCCAGACTCAAGAAAGAAAC
AAGGTAGACATTAAATTTCCTATGGCCAACACATCATTCAAACGACCATAG