Details for Chinese cabbage Locus Brara.A03151

Position : A01 ( 5`- 26453980 .. 26454627 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03151

Protein [Map View]
MSIRFSVKRLATVTISKTNGGDVSANQLEINYLQSMRDRHNEQGSTNITNGDKSTTSYVSDKAKEGVKKATDAALNAGDN
MKDAIGWRLESGEGNGVAVELKDVSQPVDTTKYRGVEELRQQTGGEDKSP*

DNA
ATGTCGATTAGGTTTTCAGTGAAGAGACTAGCGACGGTGACCATTTCAAAAACTAATGGCGGAGATGTCTCGGCTAATCA
GTTGGAGATTAATTATTTACAGAGCATGAGAGACCGTCACAACGAGCAAGGTTCAACGAACATTACAAACGGGGATAAGT
CTACAACCAGTTACGTGTCAGACAAGGCAAAAGAAGGAGTGAAGAAAGCGACGGATGCAGCCTTGAACGCCGGAGATAAC
ATGAAGGATGCGATTGGATGGCGCCTGGAAAGCGGCGAAGGAAACGGAGTCGCTGTGGAACTGAAGGATGTGAGTCAGCC
TGTCGACACGACGAAGTATAGAGGTGTGGAGGAGCTACGTCAGCAAACCGGCGGTGAAGATAAGTCACCGTGA