Details for Chinese cabbage Locus Brara.A03144

Position : A01 ( 5`- 26422188 .. 26425590 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03144

Protein [Map View]
MEGSSNSNSRGFKTSGVSDRNTEFPPVDEYVRSVFGSSTQKPSSEEEDSLGVDPFVRSLEWGDVSLRQWLDKPERSVDVL
ECLHVFRQIVEIVNAAHSQGIVVHNVKPSCFVMSSFNHVSFIESASCSDSGSEDGQKEEKGSYNKILERQIEKLEEEKKQ
RCFPMKHVLAMETSWYTSPEEEFGSPSTCASDVYRLGVLLFELFCPVTSREEKSRIMSSLRHRVLPPQILLKCHKEASFC
LWLLHPEPTCRPSMSDLLQSDFITEPRDNLVEHEAAIELRDRIEEQESLLEFLLLIQQRKQDSACSLRDTISLLSSDIEQ
VVKRQLILKKQGSSYSDLSKDDHQSPSGPSTLLASRKRFRQVIPQVETDVEVDEESQGSTLLESSRLMRNFKKLETVYFL
TRRRQMKAAALGKSLTRHSPLSSENGRGGSMISSVSNPVSNNDPLRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLN
SSNLVCALAFDRDGELFATAGVNKKIKIFEYNSIVNSNRDIHYPVVELASRSRLSSVCWNSYIKSQIASSNFEGVVQIWD
VARSQLVTEMKEHKKRVWSIDISSADPTLLASGSDDGTVKLWSINQGVSIGTIKTKANICCVQFPSDSGRSLAFGSADHK
VYYYDLRNPKIPLSTMVGHNKTVSNVKFVDSSTLVSSSTDNTLKLWDLSMSASGVNETPLHSFAGHTNLKNFVGLSVSDG
YIATGSETNEVFVYHKAFPMPVMSYMFSNTDSMSGLEIDDASQFISSICWRGQSSTLVAANSNGNIKILEMVA*

DNA
ATGGAAGGTTCTTCAAACTCCAATTCTAGAGGGTTCAAAACCTCTGGTGTTTCAGACAGGAACACTGAGTTCCCACCAGT
TGATGAGTATGTCAGAAGCGTGTTTGGTAGTAGCACACAAAAACCCTCCTCCGAAGAAGAAGATTCTTTAGGGGTTGACC
CTTTCGTTAGATCCTTGGAATGGGGTGACGTCAGCTTACGACAGTGGCTTGATAAGCCTGAACGGTCTGTAGATGTTTTA
GAGTGCTTGCACGTTTTCAGACAAATCGTGGAGATTGTGAATGCGGCTCACTCTCAAGGCATTGTTGTTCATAACGTTAA
GCCATCTTGTTTTGTCATGTCTTCTTTTAACCATGTTTCCTTCATCGAATCCGCTTCTTGTTCTGACTCCGGCTCTGAGG
ACGGCCAGAAGGAAGAGAAAGGATCATATAACAAGATTTTGGAGAGACAAATCGAGAAGCTAGAGGAAGAGAAGAAGCAA
CGTTGTTTTCCGATGAAACATGTATTAGCAATGGAGACAAGTTGGTATACTAGCCCTGAAGAGGAGTTTGGTTCTCCAAG
TACTTGTGCTTCAGATGTCTACCGTCTAGGCGTTCTTCTTTTCGAGCTATTCTGCCCTGTGACTTCAAGAGAGGAGAAGT
CAAGAATTATGTCTAGTTTAAGACATCGTGTACTTCCGCCTCAGATACTGCTCAAATGTCATAAAGAAGCTTCTTTCTGC
TTGTGGCTACTCCATCCCGAGCCAACTTGTCGACCATCAATGAGTGACTTGCTGCAGAGTGATTTTATAACCGAACCAAG
AGACAATTTGGTTGAACATGAAGCCGCGATAGAGCTGAGAGATAGAATCGAGGAACAAGAGTCGTTACTCGAGTTCTTGC
TACTGATTCAACAAAGAAAGCAAGATTCTGCTTGTAGTTTGCGGGATACTATTTCACTTCTTTCTTCAGACATTGAGCAA
GTTGTGAAGAGACAGCTGATTCTGAAGAAACAAGGAAGCTCATACTCTGATCTCAGTAAAGATGATCACCAATCTCCCTC
TGGTCCTTCTACATTGTTGGCCTCAAGAAAACGGTTTAGACAAGTGATTCCTCAAGTGGAAACAGACGTTGAAGTTGATG
AAGAGAGTCAAGGAAGCACACTTCTTGAAAGCTCCAGGTTGATGAGAAACTTCAAGAAGCTAGAAACGGTCTACTTTCTA
ACAAGGCGCAGGCAAATGAAAGCTGCTGCTTTAGGGAAATCATTAACTAGACATTCGCCTTTGAGTAGTGAAAACGGGAG
AGGAGGTTCAATGATAAGCTCAGTAAGCAACCCTGTTTCCAACAATGATCCTCTGAGACAAGGCGGGTGGATAGATCCAT
TCCTTGAGGGTTTATGCAAATACTTATCGTTCAGTAAGCTCAGAGTGAAAGCAGATTTGAAACAAGGAGACTTGTTGAAC
TCTTCTAACCTAGTTTGCGCACTTGCATTTGACCGAGATGGAGAGCTTTTCGCCACTGCTGGTGTAAACAAGAAGATCAA
GATCTTCGAATATAACTCCATTGTAAACAGTAACCGGGACATTCACTATCCGGTTGTGGAATTAGCTAGCCGGTCAAGGC
TAAGTAGTGTGTGTTGGAACAGTTACATAAAGAGTCAGATTGCATCAAGTAACTTTGAAGGCGTTGTTCAGATATGGGAT
GTTGCAAGAAGCCAGTTGGTAACAGAGATGAAGGAGCACAAGAAGAGAGTATGGTCCATTGATATTTCATCAGCAGACCC
TACTTTGCTGGCTAGTGGAAGTGATGATGGAACCGTTAAGCTATGGAGTATCAATCAGGGAGTTAGTATTGGAACCATCA
AGACAAAGGCTAATATATGCTGTGTCCAGTTCCCATCAGACTCAGGCCGGTCTTTAGCGTTCGGTTCTGCAGATCACAAA
GTGTATTACTACGATCTTAGGAACCCCAAGATTCCTCTGAGCACAATGGTTGGTCATAACAAGACAGTAAGTAATGTCAA
GTTTGTGGATTCATCCACTCTTGTGTCTTCTTCTACTGACAACACGCTGAAGCTTTGGGATTTATCCATGTCTGCTTCTG
GTGTTAATGAAACCCCTCTTCATTCATTTGCTGGACACACTAATCTAAAGAACTTTGTTGGCTTATCTGTCTCTGATGGG
TATATAGCTACAGGCTCAGAGACTAACGAGGTTTTCGTGTACCACAAGGCATTCCCAATGCCGGTGATGTCATACATGTT
CAGCAACACTGACTCCATGTCAGGTCTTGAAATCGACGATGCCTCACAGTTCATATCTTCAATCTGCTGGCGAGGACAGT
CGTCTACGCTAGTCGCTGCTAACTCCAATGGCAACATCAAGATTCTTGAAATGGTGGCTTGA