Details for Chinese cabbage Locus Brara.A03142

Position : A01 ( 5`- 26413150 .. 26414306 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03142

Protein [Map View]
MELDPKKVVEVYERYEAVGDQFLLVRNQMVENDRERNANREALTALRKKAKTTKTSVPSPFDSMMKDTHGSSAKALIQEV
CSTCGSHDSTEPTWMMLPGTDLFAAVPFHAVHTMLEKDEKRMEFESKKLQSLLKEKTLLLSELGALADSVPPSVIRSLIT
LKDKPSVQ*

DNA
ATGGAGTTGGACCCAAAGAAGGTTGTTGAAGTGTACGAGAGATATGAAGCTGTTGGTGATCAGTTTCTCCTTGTTCGAAA
TCAGATGGTGGAGAATGATAGGGAGAGGAACGCGAACCGAGAGGCTCTTACAGCACTTAGGAAGAAAGCCAAGACAACAA
AGACTAGCGTCCCTTCTCCTTTCGACTCTATGATGAAGGATACGCACGGGAGCTCAGCCAAAGCCTTGATTCAAGAAGTT
TGCTCGACGTGTGGATCTCATGACTCTACTGAACCCACCTGGATGATGCTCCCAGGAACAGATCTTTTCGCTGCGGTCCC
TTTTCATGCTGTTCACACAATGCTAGAGAAAGATGAAAAGAGAATGGAGTTTGAATCAAAGAAACTGCAGAGCTTACTCA
AGGAGAAGACTCTTTTGTTATCTGAACTTGGGGCTCTTGCTGATAGTGTTCCTCCAAGCGTCATCAGATCGCTGATTACG
TTAAAGGACAAACCTTCAGTTCAGTAG