Details for Chinese cabbage Locus Brara.A03140

Position : A01 ( 5`- 26410006 .. 26411400 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03140

Protein [Map View]
MSNQPTKDGAVPPPVSDSKAAAAAAETKPKKKICCACPDTKKLRDECIVEHGEPACAKWIEAHKMCLRAEGFNV*

DNA
ATGAGTAACCAACCAACAAAAGACGGTGCTGTTCCTCCACCCGTTTCAGATAGCAAGGCTGCTGCAGCTGCTGCAGAGAC
AAAACCAAAGAAGAAGATATGTTGTGCTTGCCCTGACACCAAGAAGCTGAGAGATGAGTGCATCGTCGAGCATGGTGAAC
CAGCTTGCGCTAAATGGATCGAAGCTCATAAAATGTGTCTCCGTGCTGAAGGTTTCAACGTCTGA