Details for Chinese cabbage Locus Brara.A03139

Position : A01 ( 5`- 26404654 .. 26407549 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03139

Protein [Map View]
MEPEIAHPVASCSATLKTTPPEANGVVNNTNVDSKNKGKSIQLEDDDEQLEGSASDCYDTTNNDESYPGSSPLSNSLLDP
DSLIYEDDDDYSDQYGYEMEDELEEEDDDGAGDYVSEYQALFDAKEKDIPAGVEVSMDWLPNSETSKSSGSGKCSRDEHG
IKPEAPSSSSKKATVGSGIHSSWNTLPHNSKGVIPNSAYALPMKTQIYNYSAHALKFSSSSSDHLEPQTPDTVMGEAPVP
APAQASSGLVLPVPNHPPWYKGHKMYPSARPRVDEVISAQSCSRVKRNMEDYLGKYLFFKKFDIVEDLGDHEYATQGTTT
KQHSKEWMKRIQEEWRILENDLPEMIFVRAYESRMDLMRAVIVGADGTPYHDGLFFFDIYFPDTYPSVPPMVHYQSGGLR
INPNLYNCGKVCLSLLGTWSGAPREKWIPNNSTMLQVLVSIQGLILNEKPYFNEPGYERTAGSAGGEAQSKAYSENTFLL
SLKTMVYNMRRPPKYFEDFSYGHFFSCAHDVLRACTAYRNGAPVASLVRGKVKEGEESSERCSEKFSQDVGITVDTLLLK
EFILLGVLGLEPEEDKPSEIDVAESSNGSPRGGMSSN*

DNA
ATGGAGCCCGAGATCGCTCACCCCGTCGCTTCTTGCTCCGCAACTCTTAAGACGACACCTCCAGAAGCTAATGGTGTTGT
TAATAACACCAATGTTGATAGTAAGAACAAAGGGAAGTCTATACAATTGGAAGACGATGATGAGCAACTTGAGGGATCTG
CTAGTGATTGTTATGACACAACCAACAACGATGAATCGTACCCTGGCTCCTCTCCATTATCAAATAGCTTGCTAGACCCT
GATTCTTTGATCTACGAAGACGACGATGACTACTCTGATCAGTACGGCTATGAGATGGAGGATGAGCTTGAGGAGGAGGA
TGATGATGGCGCTGGTGATTACGTCTCTGAGTACCAAGCCCTGTTTGATGCTAAGGAGAAGGATATCCCAGCTGGTGTTG
AGGTGTCGATGGACTGGCTTCCAAACTCTGAAACCTCTAAATCAAGTGGAAGCGGCAAGTGTTCTCGTGATGAACATGGG
ATCAAACCTGAAGCTCCAAGCAGCAGCTCCAAGAAGGCGACAGTGGGAAGTGGAATCCACTCATCTTGGAACACTTTGCC
TCACAACTCCAAAGGAGTTATACCGAACTCTGCTTACGCGTTGCCAATGAAAACTCAGATTTACAATTACTCTGCACATG
CTTTGAAGTTTTCTTCTTCTTCTTCCGATCATCTTGAGCCTCAGACTCCTGATACCGTGATGGGGGAGGCTCCGGTTCCT
GCTCCAGCGCAGGCTTCTTCTGGTTTAGTGCTTCCGGTGCCGAACCACCCACCTTGGTATAAAGGGCATAAAATGTATCC
TAGCGCTCGGCCTAGAGTGGATGAGGTTATCTCAGCTCAGAGTTGTTCCAGGGTTAAGAGAAACATGGAGGATTATCTTG
GCAAGTATTTGTTTTTTAAAAAGTTTGACATTGTTGAGGATTTGGGAGATCACGAATACGCTACTCAGGGAACAACTACA
AAGCAGCATTCCAAAGAATGGATGAAACGGATTCAAGAAGAGTGGAGAATTCTTGAGAATGATTTGCCAGAGATGATATT
TGTCAGAGCTTATGAGTCTAGGATGGACCTTATGAGGGCTGTGATTGTTGGAGCTGATGGAACTCCATACCATGACGGTC
TCTTCTTTTTCGATATCTACTTCCCGGATACATACCCTTCTGTGCCACCGATGGTTCATTACCAGTCTGGTGGGCTAAGA
ATCAACCCAAATCTGTACAACTGTGGGAAAGTGTGTCTGAGTCTTCTCGGCACTTGGAGTGGTGCACCGAGGGAGAAGTG
GATCCCCAACAACTCCACAATGCTACAGGTTCTTGTCTCGATCCAAGGTCTAATCTTGAATGAAAAGCCTTACTTCAACG
AGCCTGGCTACGAGAGAACAGCGGGTTCTGCAGGCGGTGAGGCCCAGTCTAAAGCTTACAGCGAAAACACATTCTTACTT
TCTTTGAAGACGATGGTTTACAACATGAGGAGACCACCCAAGTATTTTGAAGACTTTTCGTATGGGCATTTCTTCAGCTG
TGCTCACGACGTGTTGAGGGCGTGTACTGCTTATAGAAACGGAGCTCCAGTGGCATCTTTGGTGAGGGGAAAGGTTAAAG
AAGGGGAAGAGAGTAGCGAGAGATGCTCTGAGAAGTTTAGCCAAGATGTGGGTATCACTGTGGACACGCTTCTGTTGAAG
GAGTTCATTCTTCTAGGTGTCCTTGGTCTGGAACCTGAAGAAGACAAACCCTCAGAGATTGACGTTGCAGAGAGCAGTAA
CGGATCACCGAGAGGCGGAATGTCTTCGAATTGA