Details for Chinese cabbage Locus Brara.A03136

Position : A01 ( 5`- 26386561 .. 26389191 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03136

Protein [Map View]
MGLTTQKELFANCEGNWKRLLRFLQSVDQSSDMVQTSAGNMQVTTGRYHTLLINNSKVYSCGSSLSGVLAHGPETTQCVA
FTPIEFPFSAKVAQVSATHNHSAFVLQSGEVLTCGDNSSHCCGHLDTSRPIFRPKLVEALKGTPCKQVAAGMHFTVFLSR
EGRVFTCGSNTHGQLGHGDTLDSPVPRAVEFFQSVGPVVQIATGPSYVLAVTQDGSVYSFGSGSSFCLGHGEQQDEHQPR
VIQAFKRKGVHILRVSAGDEHAVALDSNGRVYTWGKGYCGALGHGDENDKITPQVLVSLNNCLAVQVCARKRKTFVLVEG
GVLYGFGWMGFGSLGFPDRGASDKVLRPRVLESLKPHRVSQVSTGLYHTIVVTEGGRIFGFGDNERAQLGHDSLRTCLEP
TEIFLHCGHSRSQVC*

DNA
ATGGGTTTGACTACTCAAAAGGAGCTATTTGCTAACTGTGAGGGGAACTGGAAGCGGCTTTTGAGGTTCTTGCAGTCTGT
TGACCAGTCCTCAGATATGGTTCAAACCTCTGCAGGCAATATGCAAGTTACAACAGGGAGGTATCACACGTTGCTAATCA
ACAACTCAAAGGTCTACTCTTGTGGTTCAAGTTTGTCTGGTGTGCTTGCTCATGGCCCAGAAACTACTCAATGTGTGGCA
TTTACGCCTATAGAGTTCCCATTCTCTGCTAAAGTTGCTCAGGTCTCAGCCACACATAACCATTCTGCCTTCGTATTGCA
ATCTGGAGAGGTTCTCACATGTGGGGATAACTCATCGCATTGCTGTGGTCACTTAGATACTAGCCGTCCAATTTTTAGGC
CTAAGCTTGTTGAGGCTTTGAAGGGAACTCCTTGTAAGCAGGTGGCTGCGGGGATGCACTTTACTGTGTTTCTATCAAGG
GAAGGGCGTGTGTTCACATGTGGATCAAACACACATGGACAGCTTGGTCATGGCGATACCTTGGACAGTCCAGTACCCAG
AGCTGTTGAATTTTTCCAAAGCGTTGGCCCTGTGGTGCAAATTGCAACGGGACCGAGCTATGTGCTAGCTGTGACGCAGG
ATGGCTCGGTTTACTCCTTTGGCTCTGGTTCTAGCTTCTGTCTTGGTCATGGGGAGCAGCAGGACGAGCACCAGCCACGT
GTTATTCAGGCTTTTAAAAGAAAAGGTGTTCATATACTTCGTGTCTCTGCAGGGGATGAACACGCCGTGGCACTTGATTC
CAATGGACGTGTTTACACATGGGGTAAAGGTTACTGCGGTGCTCTAGGCCATGGAGACGAAAACGACAAGATCACTCCTC
AAGTTTTGGTCAGTCTCAACAACTGCCTTGCTGTCCAGGTGTGTGCAAGAAAGAGGAAGACGTTTGTATTAGTGGAAGGT
GGAGTGTTGTATGGGTTTGGGTGGATGGGATTTGGAAGCCTAGGGTTCCCGGACAGGGGAGCTTCAGACAAAGTCCTGAG
GCCAAGAGTGTTGGAGAGTCTGAAACCACACCGTGTCTCTCAAGTTAGCACCGGTTTGTACCACACCATTGTTGTCACTG
AAGGTGGTCGCATATTTGGTTTTGGAGATAATGAAAGAGCACAGCTTGGTCACGACTCACTTCGTACCTGCTTAGAGCCA
ACCGAGATCTTTCTCCACTGTGGCCATTCTCGTAGTCAAGTTTGTTGA