Details for Chinese cabbage Locus Brara.A03135

Position : A01 ( 5`- 26384644 .. 26385966 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03135

Protein [Map View]
MLAIFQKAFAHPPEELNSPASHFSGKTPKLPGETLSDFLSLHKDTAFSMNFGHSAVLAYSRPNNSLRQRLFCGIDGVYCM
FLGTLSNLCTLNRQYGLTGKNTSEAMFVIEAYRTLRDRGPYPADQVLRGLEGSYAFVVYDTQTSSVFSALSSDGGESLYW
GISGDGSVVMSDDVKIIKQGCAKSFAPFPTGCMFHSETGLKSFEHPKNKMKAMTRIDSEGVICGANFKVDACSKINAIPR
RGSEANWALTNSR*

DNA
ATGTTGGCAATATTTCAGAAAGCGTTTGCTCACCCACCAGAGGAACTCAACAGCCCGGCGTCCCATTTCTCCGGCAAAAC
CCCAAAACTTCCCGGTGAAACTCTCTCCGACTTCCTCTCACTCCACAAGGACACGGCTTTCTCCATGAACTTCGGCCACT
CCGCCGTCTTAGCTTACTCCCGCCCCAACAACTCTCTTCGCCAGAGGTTGTTCTGTGGGATAGACGGAGTCTACTGTATG
TTTCTTGGTACATTGAGCAATCTCTGCACGTTGAACCGGCAGTACGGACTCACAGGGAAGAACACGAGCGAGGCCATGTT
TGTGATCGAAGCTTACCGAACACTACGTGACCGTGGTCCTTACCCAGCAGATCAAGTCCTTAGAGGCCTCGAAGGAAGCT
ACGCCTTTGTCGTCTACGATACTCAGACCTCCTCTGTCTTCTCAGCTTTGAGCTCTGATGGAGGAGAGAGTCTCTACTGG
GGAATCTCCGGAGATGGATCTGTTGTGATGTCTGATGATGTGAAGATCATAAAGCAAGGATGTGCTAAGTCATTTGCTCC
TTTCCCTACTGGGTGTATGTTTCACAGTGAGACAGGGCTTAAGAGCTTTGAACATCCGAAGAATAAGATGAAGGCGATGA
CGAGGATTGACAGCGAAGGTGTGATATGTGGAGCTAACTTCAAAGTGGATGCTTGTTCTAAGATCAATGCCATCCCTAGG
AGAGGAAGTGAAGCTAACTGGGCTCTCACTAATTCGCGTTAA