Details for Chinese cabbage Locus Brara.A03132

Position : A01 ( 5`- 26368712 .. 26370080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03132

Protein [Map View]
MGIQELDPLAQLSLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQLIAEIDLYKFDAWVLPSKALFGEKEWYFFSPRDRKY
PNGSRPNRVAGSGYWKATGTDKVISTEGRRVGIKKALVFYVGKAPKGTKTNWIMHEYRLIEPSRRYGSTKLDDWVLCRIY
KKQSSAQKQVYSNPMTSGREYSNNDSSTSSSSHQYNDVLESLHEIDNRSLGFAAGSSNAPPHHSHRPSLIEQKTGFLNLA
REPSFDWPSYGGHNSVPELTPSHNVPRLRYGDGGGYFQSVKTNEEDNKTQQQAEGFSADPVNGFGYSDEQHDAFGFI*

DNA
ATGGGTATCCAAGAACTCGACCCGTTGGCCCAACTAAGTTTACCACCGGGCTTCCGGTTTTACCCGACGGACGAAGAGTT
GATGGTTGAATATCTATGCAGAAAAGCCGCCGGTCATGACTTCTCTCTCCAGCTCATAGCCGAGATCGATCTTTATAAGT
TCGACGCGTGGGTCTTACCGAGTAAGGCGTTATTCGGGGAAAAAGAATGGTATTTCTTCAGCCCGAGGGATAGGAAGTAT
CCTAACGGGTCGAGACCTAACCGGGTTGCCGGGTCAGGTTACTGGAAAGCCACCGGTACGGATAAGGTTATATCGACTGA
GGGAAGAAGAGTTGGGATCAAGAAAGCTTTGGTGTTTTATGTAGGAAAAGCACCAAAAGGCACCAAAACTAATTGGATCA
TGCATGAGTACCGTCTCATCGAACCCTCCCGTAGATATGGAAGCACCAAGCTTGATGATTGGGTTTTATGCCGAATATAC
AAGAAGCAATCAAGCGCACAGAAACAGGTTTATAGTAACCCAATGACAAGTGGAAGAGAATACAGCAACAATGATTCGTC
GACGTCATCTTCCTCTCATCAATATAATGATGTTCTCGAGTCGTTACATGAGATCGATAACAGAAGTTTGGGATTTGCGG
CCGGTTCATCAAACGCACCTCCTCACCATAGTCATAGACCGAGCTTAATCGAACAGAAAACCGGGTTTCTTAATTTAGCT
AGGGAACCAAGCTTTGACTGGCCAAGCTATGGTGGGCATAACTCGGTCCCTGAACTTACACCGAGTCATAATGTTCCTCG
TCTCCGTTACGGCGACGGTGGTGGTTATTTTCAAAGTGTCAAGACAAATGAAGAAGACAATAAGACGCAGCAACAAGCTG
AGGGTTTCAGTGCTGACCCGGTAAACGGATTCGGGTACTCGGATGAACAACATGATGCTTTCGGGTTTATTTAA