Details for Chinese cabbage Locus Brara.A03130

Position : A01 ( 5`- 26336939 .. 26337423 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03130

Protein [Map View]
MQVMRRIPSGEGADMRERSETTRVRRRSHGSALRVRQACTCSGRPGSSKCVRHGFMVPSDGSREVLRRALTPPIRRMNLR
WLNFRPTPSRLCRMSSV*

DNA
ATGCAGGTTATGAGAAGGATCCCATCAGGAGAAGGCGCAGATATGCGTGAAAGATCAGAGACGACTCGGGTCAGACGTAG
GAGTCACGGTTCGGCCCTGAGAGTTCGACAGGCTTGCACGTGTTCAGGACGGCCTGGCTCGTCCAAGTGCGTGAGGCATG
GGTTTATGGTGCCGAGTGACGGAAGCAGAGAGGTGTTGCGAAGAGCTTTGACGCCTCCGATCCGGCGGATGAATCTCCGG
TGGTTGAATTTCCGGCCAACACCTAGCAGACTCTGTAGAATGTCTTCAGTTTGA