Details for Chinese cabbage Locus Brara.A03126

Position : A01 ( 5`- 26322503 .. 26322709 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03126

Protein [Map View]
MVCFCFLVDQKRKIKASKPAAGTCSRCGRGAKVADMKTSTRFCLVPFYCRSWRAIVCSFCGSVLKTYR*

DNA
ATGGTGTGTTTCTGTTTCTTGGTGGACCAGAAGAGGAAGATTAAAGCAAGCAAACCGGCGGCAGGAACGTGTTCCCGGTG
CGGTCGTGGTGCAAAAGTCGCTGACATGAAGACTTCGACGAGGTTTTGTCTTGTACCTTTTTATTGCAGATCTTGGAGAG
CCATCGTCTGCAGCTTTTGCGGCTCTGTTCTTAAAACGTACCGTTGA