Details for Chinese cabbage Locus Brara.A03124

Position : A01 ( 5`- 26306218 .. 26308512 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03124

Protein [Map View]
MLFGFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCRRLRIMKRSEATGFGLQPRGLDE*

DNA
ATGCTCTTCGGTTTCCATGGCATTGGAGTGGCCTTGAAAGATGGTGATAACTGCGAATACGTTACCATATACGAAGACAA
AGATGGAGATTGGATGCTCGCGGGAGATGTACCTTGGGGAATGTTCATAGAGTCATGCAGGAGGTTGAGGATTATGAAAA
GATCCGAGGCTACCGGATTTGGGCTGCAGCCTAGAGGATTAGACGAGTGA