Details for Chinese cabbage Locus Brara.A03120

Position : A01 ( 5`- 26291287 .. 26294166 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03120

Protein [Map View]
MLGDYDITEEDMVIDEAQGYPIAYAKICRDLDASPYRNGPPFTFMPYILQQNESSRCREADQMFPVIDPKARPATKPKIF
LSLLWKQLNHLGNAGFDPAVIRIDPYGNVLYFHADSASPLAWGFDHWFPISRGGLTVPSNLRIVQWQARKNKKDKLEFLV
PWWDLQVGISVNQFLSIFAASSSDFKRRAFSFLFREGETEELNGSQTVDSHRFPQHFIESKDKFGLASAAVVVSRREPYD
PSLVLRSLDHNRQTPARKMRLKENETPDLMKNPYQAIVAARDSLRNREEAHRMRVELKKLDDEMNDLKRKNSEEQVSIQE
LESELIKRRRRAEKCRKLAEAQCSYRNTLEKMIRDAMHQSVVYKEQVRLNQAASGALMARLEAQKAICDGSEKELHKKFK
EREELENQVRPELEKARKRSRILVNDEDGLLLEDRDKKLSLYLPGTNEDTSLQKELRVYLEEEEHKAAAASEKHGEIEEV
EEEQKTLEDVEEKLEEGKRGSRSFRAFHVFKEPENEEDEESRRERGKGNVEKWLHVLLESNSKDNLQGERSNKIDEVIEK
LDHKFPLLEKVNEEEEDVAEEAKNKVETRGESSSRRSRTSFDLKNTPEKSGRDKVVKRSESARAFRRIPSSPSLFFGMKK
GNDLVRKKPVVSGHDEENEYLVKNNFIKSSFQTIKRAVKF*

DNA
ATGTTGGGAGATTACGATATAACGGAGGAAGACATGGTAATCGACGAAGCTCAAGGCTACCCTATAGCTTACGCAAAGAT
CTGTCGCGATTTAGACGCTTCTCCGTACAGAAATGGACCTCCTTTCACCTTCATGCCTTACATCCTTCAGCAGAACGAGA
GCTCAAGATGCAGAGAAGCAGATCAGATGTTCCCTGTGATTGATCCGAAAGCAAGACCAGCAACAAAACCAAAGATCTTC
CTAAGTCTACTATGGAAACAACTCAATCATCTAGGAAATGCTGGGTTTGATCCAGCTGTGATCCGGATTGATCCATATGG
GAATGTTCTCTACTTCCACGCTGATTCAGCTTCTCCTCTTGCTTGGGGTTTTGATCATTGGTTCCCTATCTCAAGAGGAG
GTTTAACAGTACCAAGCAACCTAAGGATAGTGCAGTGGCAAGCACGCAAGAACAAGAAGGACAAACTCGAGTTCCTCGTA
CCATGGTGGGATCTTCAAGTCGGCATCTCAGTAAACCAGTTCCTCTCTATCTTCGCCGCTTCGAGTTCTGATTTCAAGAG
GAGAGCATTTTCATTCTTGTTCAGAGAAGGCGAAACCGAGGAGCTCAACGGCTCACAAACAGTTGACTCACATCGTTTCC
CGCAGCATTTTATTGAATCAAAAGACAAGTTTGGTCTTGCGTCAGCTGCAGTTGTTGTCTCTAGAAGAGAGCCTTATGAC
CCTTCTTTAGTACTGAGATCACTTGATCACAATCGTCAAACACCTGCGAGGAAGATGAGACTCAAAGAGAATGAGACGCC
AGATTTAATGAAGAATCCGTATCAAGCCATTGTTGCTGCTAGGGACTCACTCAGAAACCGAGAGGAAGCGCATAGAATGA
GAGTTGAGCTGAAGAAGTTAGATGATGAGATGAATGATTTGAAGAGAAAGAACAGTGAAGAGCAGGTTAGTATCCAGGAG
CTTGAGAGCGAGCTGATTAAGCGGAGGAGAAGAGCTGAGAAGTGCAGGAAGTTGGCGGAAGCTCAGTGCTCTTATAGGAA
CACACTCGAGAAGATGATCCGTGATGCTATGCACCAGAGTGTTGTGTATAAGGAACAAGTGAGGTTAAACCAGGCGGCTA
GTGGTGCACTGATGGCGAGACTAGAGGCGCAGAAGGCGATTTGTGACGGTTCGGAGAAGGAGCTTCACAAGAAGTTTAAG
GAAAGAGAGGAGCTGGAGAATCAAGTGAGGCCTGAACTGGAGAAAGCAAGGAAAAGATCAAGAATCTTGGTGAATGATGA
AGATGGGCTGCTGCTGGAGGATAGAGATAAGAAGCTGTCTTTGTATCTCCCTGGAACAAATGAAGATACCTCATTACAAA
AGGAGTTGAGAGTGTACCTTGAAGAAGAAGAACATAAAGCAGCAGCAGCTTCTGAGAAGCATGGGGAAATAGAGGAAGTG
GAAGAGGAGCAGAAGACATTAGAAGATGTTGAAGAGAAGCTAGAAGAAGGGAAGAGAGGGAGCAGAAGCTTTAGAGCATT
TCATGTATTCAAGGAACCAGAGAATGAGGAAGATGAGGAAAGCAGGAGAGAGCGAGGGAAAGGAAACGTCGAGAAATGGC
TCCACGTTTTACTGGAAAGCAACAGCAAAGACAACCTTCAAGGTGAAAGAAGCAATAAGATTGATGAAGTGATTGAGAAA
CTAGACCACAAGTTCCCTCTACTTGAAAAGGTTAATGAAGAAGAAGAAGATGTGGCTGAGGAGGCAAAGAACAAGGTGGA
AACAAGAGGTGAAAGCAGCTCGCGTAGAAGCAGAACCAGTTTTGATTTGAAGAACACACCGGAGAAGAGCGGGAGAGATA
AAGTGGTGAAGAGATCAGAGAGTGCTAGAGCTTTCAGAAGGATCCCATCATCTCCTTCACTCTTCTTTGGAATGAAAAAG
GGAAATGACCTCGTCAGGAAGAAGCCAGTGGTCTCAGGTCACGATGAAGAGAACGAGTATCTCGTTAAGAACAACTTCAT
CAAGTCATCTTTCCAAACAATCAAAAGAGCTGTCAAATTCTAG