Details for Chinese cabbage Locus Brara.A03118

Position : A01 ( 5`- 26281242 .. 26284019 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03118

Protein [Map View]
MRRLPSSVCSPSSHRLNPITSMSTGSNSLIWFRKGLRVHDNPALEHASKASSGSMYPVFVIDPRYMDPDPSAFSPGSSRA
GVNRIRFLLESLKDLDSGLKKLGSRLLVLRGEPGEVLVRCLQEWKVRRLCFEYDTDPYYQALDFKVKEYASSVGVEVFSP
VSHTLFNPTDIIQKNGGKAPLSYQSFLKIAGEPSCAESELVMSYSSLPPIGDVGSLGVSEVPTLEELGYREDEQAEWTPF
RGGESEALKRLHKSISDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQRVYKDVKKHTSPPVSLLGQ
LLWREFFYTTAFGTRNFDKMKGNPICKQIPWKEDHDMLAAWRDGKTGYPWIDAIMVQLLKWGWMHHLARHSVACFLTRGD
LFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNRIYSPVSFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWT
APLSVQTKAKCIVGKDYPKPITMHDAASKECKRKMGEAYALNKKMNGNIGDDDLKDLRRKLETDGESNIRNQRPKLN*

DNA
ATGCGACGACTACCTTCCTCCGTCTGTTCACCGTCAAGTCACCGTCTCAACCCCATAACATCAATGTCTACCGGATCCAA
TTCACTGATTTGGTTCCGTAAAGGTCTCCGTGTCCACGACAACCCGGCTCTCGAACACGCCTCAAAGGCCTCCTCCGGAT
CCATGTACCCGGTTTTCGTGATCGACCCGCGTTACATGGATCCGGACCCATCTGCGTTCTCCCCCGGTTCGTCGCGCGCG
GGAGTAAACCGGATCCGGTTCTTGCTGGAGAGCCTCAAGGATCTCGATTCCGGTTTGAAGAAACTCGGTTCGCGGTTGCT
CGTTCTGAGAGGTGAACCCGGTGAGGTCCTGGTTCGTTGCTTGCAAGAGTGGAAGGTGAGGAGGCTTTGCTTTGAGTATG
ATACTGATCCGTATTACCAAGCTCTAGACTTTAAAGTCAAGGAGTATGCTTCTTCGGTTGGTGTTGAGGTTTTCTCTCCA
GTGAGCCATACTCTTTTCAATCCCACTGATATTATACAGAAAAATGGTGGGAAGGCACCTTTGAGTTATCAGTCGTTTCT
GAAGATCGCTGGGGAGCCTTCTTGTGCTGAATCTGAGCTTGTGATGTCTTATTCTTCACTTCCACCGATTGGAGATGTTG
GGAGTCTTGGAGTTTCGGAAGTTCCAACACTTGAGGAGCTTGGATACAGAGAGGATGAACAAGCTGAATGGACGCCTTTT
AGAGGTGGTGAATCAGAAGCTTTGAAACGATTGCACAAGTCAATCAGTGATAAGGCATGGGTGGCTAACTTTGAGAAACC
AAAGGGTGATCCATCTGCATTCTTGAAGCCTGCAACTACTGTTTTGTCACCTTATTTGAAATTTGGATGCCTGTCTTCGA
GGTACTTTTATCAATGCCTTCAACGTGTTTATAAGGATGTGAAAAAGCATACATCGCCGCCAGTTTCTCTCCTTGGACAG
TTGTTGTGGCGAGAATTTTTCTATACCACTGCGTTTGGAACTCGTAACTTTGACAAAATGAAGGGAAACCCAATCTGCAA
ACAGATTCCATGGAAAGAGGATCATGATATGTTGGCTGCTTGGAGGGACGGTAAGACAGGATACCCTTGGATTGATGCCA
TCATGGTTCAGCTTCTGAAATGGGGTTGGATGCACCATCTAGCGCGTCACTCTGTCGCCTGTTTCCTAACTCGTGGGGAT
CTGTTCATACACTGGGAACAAGGGCGTGATGTGTTCGAGAGGCTTTTGATTGATTCAGACTGGGCAATTAATAATGGGAA
CTGGATGTGGTTATCATGTTCCTCCTTCTTTTATCAGTACAATCGCATATACTCACCTGTATCTTTTGGAAAGAAGTATG
ATCCTGATGGCAAGTACATTAGGCATTTTCTCCCGGTCCTGAAAGATATGCCAAAGCAGTATATTTATGAGCCATGGACA
GCGCCGTTGAGCGTTCAAACTAAAGCTAAGTGCATAGTCGGAAAGGACTACCCAAAGCCAATAACTATGCATGATGCAGC
AAGCAAGGAGTGCAAGAGGAAGATGGGTGAAGCATATGCATTGAACAAGAAGATGAACGGTAACATCGGTGACGATGACT
TGAAGGATTTGAGGAGAAAGCTTGAGACAGATGGAGAATCTAACATCAGGAATCAACGACCAAAACTCAACTAA