Details for Chinese cabbage Locus Brara.A03116

Position : A01 ( 5`- 26272988 .. 26275135 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03116

Protein [Map View]
MWRRIVSSHLKSLAADVAAASPRRSIATTTARPVGFHLAANRSAVSASSFVTPRHFSSESVESVAKKKVEDVMPIATGHE
KEELEAELEGRRLLDIDFPEGPFGTKESPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVG
PGGPPDGHGDEDDHH*

DNA
ATGTGGAGAAGAATCGTCTCCTCTCATCTCAAATCCCTAGCCGCCGATGTCGCCGCTGCTTCTCCTCGCCGATCCATAGC
CACCACCACCGCGAGGCCTGTTGGTTTCCATCTTGCCGCCAATCGATCAGCCGTCTCCGCTTCTTCGTTCGTTACCCCTC
GCCATTTCAGCTCTGAATCAGTAGAGAGCGTTGCGAAGAAGAAGGTGGAGGATGTAATGCCCATTGCAACCGGACATGAG
AAGGAAGAGCTTGAAGCTGAATTGGAGGGAAGGAGGCTGCTTGACATTGACTTCCCCGAAGGTCCTTTTGGTACAAAGGA
ATCCCCTGCTATTGTAAAATCATACTATGACAAGCGGATTGTGGGATGCCCTGGTGGTGAAGGCGAGGATGAACACGACG
TTGTGTGGTTCTGGCTGGAGAAAGGAAAATCTTTTGAATGCCCTGTTTGCACTCAGTACTTTGAGCTGGAAGTGGTTGGT
CCTGGTGGGCCTCCCGATGGTCACGGCGATGAAGACGACCACCACTGA